ADAT1 Polyclonal antibody

• 

  WB analysis of mouse ovary using 15482-1-AP

  mouse ovary tissue were subjected to SDS PAGE followed by western blot with 15482-1-AP (ADAT1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse ovary using 15482-1-AP

  mouse ovary tissue were subjected to SDS PAGE followed by western blot with 15482-1-AP (ADAT1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human heart using 15482-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 15482-1-AP (ADAT1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of MCF-7 using 15482-1-AP

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using 15482-1-AP (ADAT1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

ADAT1 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 15482-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

tRNA-specific adenosine-37 deaminase, tRNA-specific adenosine deaminase 1, hADAT1, EC:3.5.4.34, ADAT 1

---

Tested Applications

• Positive WB detected in: mouse ovary tissue, human heart tissue
• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15482-1-AP targets ADAT1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7824

  Product name: Recombinant human ADAT1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 156-502 aa of BC002758

  Sequence: QPCCPVFRNWAHNSSVEASSNLEAPGNERKCEDPDSPVTKKMRLEPGTAAREVTNGAAHHQSFGKQKSGPISPGIHSCDLTVEGLATVTRIAPGSAKVIDVYRTGAKCVPGEAGDSGKPGAAFHQVGLLRVKPGRGDRTRSMSCSDKMARWNVLGCQGALLMHLLEEPIYLSAVVIGKCPYSQEAMQRALIGRCQNVSALPKGFGVQELKILQSDLLFEQSRSAVQAKRADSPGRLVPCGAAISWSAVPEQPLDVTANGFPQGTTKKTIGSLQARSQISKVELFRSFQKLLSRIARDKWPHSLRVQKLDTYQEYKEAASSYQEAWSTLRKQVFGSWIRNPPDYHQFK

• Full Name: adenosine deaminase, tRNA-specific 1
• Calculated Molecular Weight: 55 kDa
• Observed Molecular Weight: 55 kDa
• GenBank Accession Number: BC002758
• Gene Symbol: ADAT1
• Gene ID (NCBI): 23536
• RRID: AB_2222792
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BUB4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.