ADAT2 Polyclonal antibody

• 

  WB analysis of A431 using 13621-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 13621-1-AP (ADAT2 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse pancreas using 13621-1-AP

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 13621-1-AP (ADAT2 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A431 using 13621-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 13621-1-AP (ADAT2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 13621-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 13621-1-AP (ADAT2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 13621-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 13621-1-AP (ADAT2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse pancreas using 13621-1-AP

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 13621-1-AP (ADAT2 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse brain using 13621-1-AP

  IP result of anti-ADAT2 (IP:13621-1-AP, 4ug; Detection:13621-1-AP 1:300) with mouse brain tissue lysate 3000 ug.

• 

  IHC staining of human hepatocirrhosis using 13621-1-AP

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis using 13621-1-AP (ADAT2 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human hepatocirrhosis using 13621-1-AP

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis using 13621-1-AP (ADAT2 antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human colon cancer using 13621-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 13621-1-AP (ADAT2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 13621-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 13621-1-AP (ADAT2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human hepatocirrhosis using 13621-1-AP

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis using 13621-1-AP (ADAT2 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human hepatocirrhosis using 13621-1-AP

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis using 13621-1-AP (ADAT2 antibody) at dilution of 1:50 (under 40x lens).

• 

  IF Staining of A431 using 13621-1-AP

  Immunofluorescent analysis of A431 cells using 13621-1-AP (ADAT2 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

ADAT2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 13621-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

tRNA-specific adenosine deaminase 2, TAD2, EC:3.5.4.33, Deaminase domain-containing protein 1, DEADC1

---

Tested Applications

• Positive WB detected in: A431 cells, mouse brain tissue, mouse pancreas tissue
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: human hepatocirrhosis tissue, human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

13621-1-AP targets ADAT2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4529

  Product name: Recombinant human ADAT2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 33-193 aa of BC037955

  Sequence: HMAKEALENTEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQVLDWCRQSGKSPSEVFEHTVLYVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGCGSVLNIASADLPNTGRPFQCIPGYRAEEAVEMLKTFYKQENPNAPKSKVRKKECQKS

• Full Name: adenosine deaminase, tRNA-specific 2, TAD2 homolog (S. cerevisiae)
• Calculated Molecular Weight: 191 aa, 21 kDa
• Observed Molecular Weight: 25 kDa
• GenBank Accession Number: BC037955
• Gene Symbol: ADAT2
• Gene ID (NCBI): 134637
• RRID: AB_10642142
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7Z6V5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ADAT2(tRNA-specific adenosine deaminase 2) is also named as DEADC1 and Belongs to the cytidine and deoxycytidylate deaminase family. It is a 24-kDa molecular mass protein that harbors all the conserved motifs required for deamination. ADAT2 and ADAT3 can function as a heterodimer which catalyses inosine formation at the wobble position (position 34) in eukaryotic tRNAs(PMID:12457566). It has 2 isoforms produced by alternative splicing.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nucleic Acids Res; The structure of the mouse ADAT2/ADAT3 complex reveals the molecular basis for mammalian tRNA wobble adenosine-to-inosine deamination.; Authors - Elizabeth Ramos-Morales