ADCY2 Polyclonal antibody

• 

ADCY2 Polyclonal Antibody for ELISA

Cat No. 21547-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

ELISA

Synonyms

AC2, ADCY2, adenylate cyclase 2 (brain), Adenylate cyclase type 2, Adenylate cyclase type II, Adenylyl cyclase 2, ATP pyrophosphate lyase 2, HBAC2, KIAA1060

---

Product Information

21547-1-AP targets ADCY2 in ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16210

  Product name: Recombinant human ADCY2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 508-610 aa of BC111743

  Sequence: AHLHHRDSMTTENGKISTTDVPMGQHNFQNRTLRTKSQKKRFEEELNERMIQAIDGINAQKQWLKSEDIQRISLLFYNKVLEKEYRATALPAFKYYVTCACLI

• Full Name: adenylate cyclase 2 (brain)
• Calculated Molecular Weight: 1091 aa, 124 kDa
• GenBank Accession Number: BC111743
• Gene Symbol: ADCY2
• Gene ID (NCBI): 108
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q08462
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.