ADGB Polyclonal antibody

• 

  WB analysis using 31756-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31756-1-AP (ADGB antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse testis using 31756-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 31756-1-AP (C6orf103 antibody) at dilution of 1:100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat testis using 31756-1-AP

  Immunohistochemical analysis of paraffin-embedded rat testis tissue slide using 31756-1-AP (C6orf103 antibody) at dilution of 1:100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat testis using 31756-1-AP

  Immunohistochemical analysis of paraffin-embedded rat testis tissue slide using 31756-1-AP (C6orf103 antibody) at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse testis using 31756-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse testis tissue using ADGB antibody (31756-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

ADGB Polyclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 31756-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, ELISA

Synonyms

C6orf103, Androglobin, Calpain 7 like protein, Calpain-7-Like Protein, CAPN7L

---

Tested Applications

• Positive WB detected in: A431 cells
• Positive IHC detected in: rat testis tissue, mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31756-1-AP targets ADGB in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36246

  Product name: Recombinant human C6orf103 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 550-700 aa of NM_024694

  Sequence: ETATHSQTDLSQITKATSQGNTASQVILGKGTDEQTDFGLGDAHQSDGLNLEREIVSQTTATQEKSQEELPTTNNSVSKEIWLDFEDFCVCFQNIYIFHKPSSYCLNFQKSEFKFSEERVSYYLFVDSLKPIELLVCFSALVRWGEYGAL

• Full Name: chromosome 6 open reading frame 103
• Calculated Molecular Weight: 189kDa
• Observed Molecular Weight: 235 kDa
• GenBank Accession Number: NM_024694
• Gene Symbol: C6orf103
• Gene ID (NCBI): 79747
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8N7X0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ADGB (Androglobin) is an evolutionarily conserved member of the globin protein family. It is specifically and highly expressed in spermatogenic cells (particularly sperm cells) of mammalian testes and in ciliated cells across various tissues. The ADGB protein possesses a unique structure, comprising a globin domain and a calmodulin-binding domain, suggesting its potential role in integrating gas (such as oxygen) sensing with calcium ion signaling functions. Current research indicates that ADGB plays a critical role in spermatogenesis within the male reproductive system, as well as in the formation and functional maintenance of cilia. Its functional deficiency may lead to abnormal sperm morphology and motility defects, thereby affecting male fertility. The target protein ADGB has a size of 235 kDa. This protein is unstable and prone to degradation, with degradation bands observed at 135 kDa, 70 kDa, and 55 kDa. (PMID: 36995441)