ADHFE1 Polyclonal antibody

• 

  WB analysis of mouse heart using 19359-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 19359-1-AP (ADHFE1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse kidney using 19359-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 19359-1-AP (ADHFE1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse heart using 19359-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 19359-1-AP (ADHFE1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat kidney using 19359-1-AP

  rat kidney tissue were subjected to SDS PAGE followed by western blot with 19359-1-AP (ADHFE1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse kidney using 19359-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 19359-1-AP (ADHFE1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse heart using 19359-1-AP

  IP result of anti-ADHFE1 (IP:19359-1-AP, 4ug; Detection:19359-1-AP 1:300) with mouse heart tissue lysate 4000ug.

• 

  IHC staining of human colon using 19359-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 19359-1-AP (ADHFE1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon using 19359-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 19359-1-AP (ADHFE1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 19359-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 19359-1-AP (ADHFE1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 19359-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 19359-1-AP (ADHFE1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 19359-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 19359-1-AP (ADHFE1 Antibody) at dilution of 1:50(under 10x lens).

• 

  IHC staining of human liver using 19359-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 19359-1-AP (ADHFE1 Antibody) at dilution of 1:50(under 40x lens).

ADHFE1 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 19359-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, IHC, ELISA

Synonyms

ADH8, ADHFE1, HMFT2263, HOT

---

Tested Applications

• Positive WB detected in: mouse heart tissue, mouse kidney tissue, rat kidney tissue
• Positive IP detected in: mouse heart tissue
• Positive IHC detected in: human colon tissue, human colon cancer tissue, human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

19359-1-AP targets ADHFE1 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6803

  Product name: Recombinant human ADHFE1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-255 aa of BC064634

  Sequence: MAVSNIRYGAAVTKEVGMDLKNMGAKNVCLMTDKNLSKLPPVQVAMDSLVKNGIPFTVYDNVRVEPTDSSFMEAIEFAQKGAFDAYVAVGGGSTMDTCKAANLYASSPHSDFLDYVSAPIGKGKPVSVPLKPLIAVPTTSGTGSETTGVAIFDYEHLKVKIGITSRAIKPTLGLIDPLHTLHMPARVVANSGFDVLCHALESYTTLPYHLRSPCPSNPITRPAYQGSNPISDIWAIHALRIVAKYLKRAVNSTDK

• Full Name: alcohol dehydrogenase, iron containing, 1
• Calculated Molecular Weight: 50 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC064634
• Gene Symbol: ADHFE1
• Gene ID (NCBI): 137872
• RRID: AB_10644280
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IWW8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.