ADI1 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• ADI1 Recombinant monoclonal antibody (87964-1-RR)

• 

  WB analysis using 87964-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87964-1-RR (ADI1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

ADI1 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87964-1-RR

Clone No.260044G10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Acireductone dioxygenase, ADI 1, APL1, ARD, ARD'

---

Tested Applications

• Positive WB detected in: HepG2 cells, A172 cells, MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87964-1-RR targets ADI1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg5924

  Product name: Recombinant human MTND protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 1-179 aa of NM_018269.3

  Sequence: MVQAWYMDDAPGDPRQPHRPDPGRPVGLEQLRRLGVLYWKLDADKYENDPELEKIRRERNYSWMDIITICKDKLPNYEEKIKMFYEEHLHLDDEIRYILDGSGYFDVRDKEDQWIRIFMEKGDMVTLPAGIYHRFTVDEKNYTKAMRLFVGEPVWTAYNRPADHFEARGQYVKFLAQTA

• Full Name: acireductone dioxygenase 1
• Calculated Molecular Weight: 21 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: NM_018269.3
• Gene Symbol: ADI1
• Gene ID (NCBI): 55256
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9BV57-1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ADI1(acireductone dioxygenase 1 ) is also named as SIPL, ARD, APL1, HMFT1638, MTCBP-1, FLJ10913, MTCBP1 and belongs to the acireductone dioxygenase (ARD) family. It catalyzes the formation of formate and 2-keto-4-methylthiobutyrate (KMTB) from 1,2-dihydroxy-3-keto-5-methylthiopentene (DHK-MTPene).The downregulation of ADI1 protein expression in human prostate cancer specimens argues that ADI1 potentially inhibits the growth that occurs during prostate cancer progression(PMID:17786183).