Product Information
17181-1-AP targets ADIG in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag10910 Product name: Recombinant human ADIG protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-80 aa of BC029594 Sequence: MKYPLMPLVNDLTFSFLVFWFCLPVGLLLLLIIWLRFLLSQDSEENDSSVCLDWEPWSKGPAEFCWKGTLHGQEKERPCW Predict reactive species |
| Full Name | adipogenin |
| Calculated Molecular Weight | 80 aa, 10 kDa |
| GenBank Accession Number | BC029594 |
| Gene Symbol | ADIG |
| Gene ID (NCBI) | 149685 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q0VDE8 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Publications
What published studies show
The ADIG polyclonal antibody (Cat# 17181-1-AP) has 1 citation to date. It appears in the FASEB Journal (2025), in a study investigating a METTL11A-MAFG-NPL4 feedback regulation loop that promotes bladder cancer cell proliferation and tumor progression. The research field is oncology, specifically bladder cancer biology. The antibody was used for Western blot analysis in human samples.
| Species | Application | Title |
|---|---|---|
FASEB J A novel feedback regulation loop of METTL11A-MAFG-NPL4 promotes bladder cancer cell proliferation and tumor progression |
