Adiponectin Recombinant monoclonal antibody, PBS Only

Adiponectin Uni-rAb® Recombinant Antibody for IF/ICC, Indirect ELISA
Cat No. 83961-1-PBS
Clone No.241082C11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC, Indirect ELISA

ADIPOQ, 241082C11, 30 kDa adipocyte complement-related protein, Adipocyte complement-related 30 kDa protein, Adipocyte, C1q and collagen domain-containing protein

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83961-1-PBS targets Adiponectin in IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag16304

Product name: Recombinant human ADIPOQ protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-244 aa of BC096308

Sequence: MLLLGAVLLLLALPGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN

Predict reactive species
Full Name adiponectin, C1Q and collagen domain containing
Calculated Molecular Weight 244 aa, 26 kDa
GenBank Accession NumberBC096308
Gene Symbol Adiponectin
Gene ID (NCBI) 9370
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ15848
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Adiponectin (AdipoQ), an adipocyte-derived hormone, is one of the most abundant adipokines in the blood circulation. Adiponectin modulates a number of metabolic processes, including improving INS sensitivity and anti-inflammatory activity. The role of AdipoQ in reproduction is not yet fully understood, but the expression of AdipoQ in reproductive tissues has been observed in various animals and humans, including chicken testis, bovine ovary, and human placenta. Adiponectin exerts its effects by activating a range of different signaling molecules via binding to two transmembrane AdipoQ receptors, AdipoR1 and AdipoR2. AdipoR1 is expressed primarily in the skeletal muscle, whereas AdipoR2 is predominantly expressed in the liver. AdipoQ May play a role in cell growth, angiogenesis and tissue remodeling by binding and sequestering various growth factors.

Loading...
||
New chat Able
正在加载,请稍候...