ADNP2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ADNP2 Polyclonal antibody (17860-1-AP)

• 

  IP experiment of U2OS using 17860-1-AP

  IP result of anti-ADNP2 (IP:17860-1-AP, 4ug; Detection:17860-1-AP 1:600) with U2OS cells lysate 760 ug.

• 

  IF Staining of U2OS using 17860-1-AP

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using ADNP2 antibody (17860-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

ADNP2 Polyclonal Antibody for IF/ICC, IP, ELISA

Cat No. 17860-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, IP, ELISA

Synonyms

Activity-dependent neuroprotector homeobox protein 2, ADNP 2, KIAA0863, ZNF508

---

Tested Applications

• Positive IP detected in: U2OS cells
• Positive IF/ICC detected in: U2OS cells

Recommended dilution

• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17860-1-AP targets ADNP2 in IF/ICC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12327

  Product name: Recombinant human ADNP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 784-1132 aa of BC071589

  Sequence: GLSEHSRNRHLGKKKLPMDYSNRGFQLDVDANGNLLFPHLDFITILPKEKLGEREVYLAILAGIHSKSLVPVYVKVRPQAEGTPGSTGKRVSTCPFCFGPFVTTEAYELHLKERHHIMPTVHTVLKSPAFKCIHCCGVYTGNMTLAAIAVHLVRCRSAPKDSSSDLQAQPGFIHNSELLLVSGEVMHDSSFSVKRKLPDGHLGAEDQRHGEEQPPILNADAAPGPEKVTSVVPFKRQRNESRTEGPIVKDEALQILALDPKKYEGRSYEEKKQFLKDYFHKKPYPSKKEIELLSSLFWVWKIDVASFFGKRRYICMKAIKNHKPSVLLGFDMSELKNVKHRLNFEYEP

• Full Name: ADNP homeobox 2
• Calculated Molecular Weight: 1131 aa, 123 kDa
• Observed Molecular Weight: 123 kDa
• GenBank Accession Number: BC071589
• Gene Symbol: ADNP2
• Gene ID (NCBI): 22850
• RRID: AB_3741938
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6IQ32
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Activity-dependent neuroprotective protein (ADNP) 2 (KIAA0863; ZNF508) gene, a homeobox-profile containing gene, was identified in a screen for homologous proteins to ADNP. The human ADNP2 contains 1131 amino acid residues with a molecular weight of 122.8 KDa. During development, a relatively high level of ADNP2 gene expression was found in the embryonic mouse brain and was sustained throughout embryogenesis and adulthood. Activity-dependent neuroprotective protein (ADNP), an early marker essential for brain formation, interacts with microtubule end-binding proteins (EB1, EB2, and EB3). EB1 and EB3 are highly expressed in neurons (axons and dendritic spines, respectively) and EB1 enhancement of neurite outgrowth is attenuated by EB2. (PMID: 26315608, PMID: 18179478)