ADRB2 Recombinant monoclonal antibody, PBS Only

• 

  IF Staining of A431 using 83317-5-RR (same clone as 83317-5-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using ADRB2 antibody (83317-5-RR, Clone: 240186C9 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). This data was developed using the same antibody clone with 83317-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83317-5-PBS

  Biolayer interferometry (BLl) kinetic assays of 83317-5-RR against Human ADRB2 were performed. The affinity constant is 53.9 pM.

ADRB2 Uni-rAb^® Recombinant Antibody for IF/ICC, ELISA

Cat No. 83317-5-PBS

Clone No.240186C9

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

IF/ICC, ELISA

Synonyms

ADRB2, ADRB2R, ADRBR, B2AR, BAR, Beta 2 adrenergic receptor, Beta 2 adrenoceptor, Beta 2 adrenoreceptor, BETA2AR

---

Product Information

83317-5-PBS targets ADRB2 in IF/ICC, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag3715

  Product name: Recombinant human ADRB2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 220-413 aa of BC012481

  Sequence: SRVFQEAKRQLQKIDKSEGRFHVQNLSQVEQDGRTGHGLRRSSKFCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQDNLIRKEVYILLNWIGYVNSGFNPLIYCRSPDFRIAFQELLCLRRSSLKAYGNGYSSNGNTGEQSGYHVEQEKENKLLCEDLPGTEDFVGHQGTVPSDNIDSPGRNCSTNDSLL

• Full Name: adrenergic, beta-2-, receptor, surface
• Calculated Molecular Weight: 46 kDa
• GenBank Accession Number: BC012481
• Gene Symbol: ADRB2
• Gene ID (NCBI): 154
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P07550
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.