ADSSL1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ADSSL1 Polyclonal antibody (34472-1-AP)

• 

  WB analysis using 34472-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 34472-1-AP (ADSSL1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

ADSSL1 Polyclonal Antibody for WB, ELISA

Cat No. 34472-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

Adenylosuccinate synthetase isozyme 1, Adenylosuccinate synthetase, basic isozyme, Adenylosuccinate synthetase, muscle isozyme, Adenylosuccinate synthetase-like 1, AdSS 1

---

Tested Applications

• Positive WB detected in: mouse heart tissue, mouse skeletal muscle tissue, rat heart tissue, rat skeletal muscle tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

34472-1-AP targets ADSSL1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag40667

  Product name: Recombinant human ADSSL1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 365-457 aa of BC047904

  Sequence: DILDVLGEVKVGVSYKLNGKRIPYFPANQEMLQKVEVEYETLPGWKADTTGARRWEDLPPQAQNYIRFVENHVGVAVKWVGVGKSRESMIQLF

• Full Name: adenylosuccinate synthase like 1
• Calculated Molecular Weight: 457 aa, 50 kDa
• Observed Molecular Weight: 45-50 kDa
• GenBank Accession Number: BC047904
• Gene Symbol: ADSSL1
• Gene ID (NCBI): 122622
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8N142
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Adenylosuccinate synthase (ADSSL1) is a muscle specific enzyme involved in the purine nucleotide cycle and responsible for the conversion of inosine monophosphate to adenosine monophosphate (PMID: 32331917).