AFAP1L1 Polyclonal antibody

• 

  WB analysis of COS-7 using 23909-1-AP

  COS-7 cells were subjected to SDS PAGE followed by western blot with 23909-1-AP (AFAP1L1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

AFAP1L1 Polyclonal Antibody for WB, ELISA

Cat No. 23909-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, monkey

Applications

WB, ELISA

Synonyms

AFAP1 like protein 1, AFAP1L1

---

Tested Applications

• Positive WB detected in: COS-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

23909-1-AP targets AFAP1L1 in WB, ELISA applications and shows reactivity with human, monkey samples.

• Tested Reactivity: human, monkey
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21006

  Product name: Recombinant human AFAP1L1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-117 aa of BC125093

  Sequence: MDRGQVLEQLLPELTGLLSLLDHEYLSDTTLEKKMAVASILQSLQPLPAKEVSYLYVNTADLHSGPSFVESLFEEFDCDLSDLRDMPEDDGEPSKGASPELAKSPRLRNAADLPPPL

• Full Name: actin filament associated protein 1-like 1
• Calculated Molecular Weight: 768 aa, 86 kDa
• Observed Molecular Weight: 75-86 kDa
• GenBank Accession Number: BC125093
• Gene Symbol: AFAP1L1
• Gene ID (NCBI): 134265
• RRID: AB_2879358
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q8TED9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Actin Filament-Associated Protein of 110 kDa (AFAP-110/AFAP1) is an adaptor protein with multiple protein binding motifs that is known to function as both an actin binding protein and a cSrc activating protein. A homology search of AFAP1 recently identified AFAP1L1 which has a similar sequence, domain structure and cellular localization. AFAP1L1 is highly expressed in human breast, colon and brain tissue. AFAP1L1 interacts with cortactin and involves the invadosomes formation. AFAP1L1 as a prognostic marker has a role in the progression of spindle cell sarcomas.