AFTPH Polyclonal antibody

• 

  WB analysis of Transfected HEK-293 using 11785-1-AP

  Transfected HEK-293 cells were subjected to SDS PAGE followed by western blot with 11785-1-AP (AFTPH Antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

AFTPH Polyclonal Antibody for WB, ELISA

Cat No. 11785-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

AFTH, aftiphilin, AFTPH, Nbla10388

---

Product Information

11785-1-AP targets AFTPH in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2402

  Product name: Recombinant human AFTPH protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-166 aa of BC022247

  Sequence: NKKLLSSLGIDTRNILFTGNKKQPVIVPMYAAGLGMLEPTKEPLKPLSAAEKIASIGQTATMSPDMNTCTSDQFQESLPPVQFDWSSSGLTNPLDGVDPELYELTTSKLEISTSSLKVTDAFARLMSTVEKTSTSTRKPKREGHLSEEAIKVIAGLPDLTFMHAKV

• Full Name: aftiphilin
• Calculated Molecular Weight: 937 aa, 102 kDa
• GenBank Accession Number: BC022247
• Gene Symbol: AFTPH
• Gene ID (NCBI): 54812
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6ULP2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Aftiphilin is a component of the clathrin machinery in neurons, binding to of clathrin adaptor protein 1 and 2. Western assay showed that the protein emigrate as a 126 kDa protein in SDS PAGE, with larger molecular weight than the predicted size (99 and 102 kDa for the two isoforms).