AGBL3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• AGBL3 Polyclonal antibody (16990-1-AP)

• Featured Product
• KD/KO Validated

AGBL3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 16990-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

ATP/GTP-binding protein-like 3, CBPC3, CCP3, Cytosolic carboxypeptidase 3, EC:3.4.17.-

• 

  WB analysis of mouse liver using 16990-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 16990-1-AP (AGBL3 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of L02 using 16990-1-AP

  L02 cells were subjected to SDS PAGE followed by western blot with 16990-1-AP (AGBL3 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 16990-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 16990-1-AP (AGBL3 Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 16990-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 16990-1-AP (AGBL3 Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 16990-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 16990-1-AP (AGBL3 Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 16990-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 16990-1-AP (AGBL3 Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for AGBL3 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse liver tissue, L02 cells
• Positive IHC detected in: human lung cancer tissue, human testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16990-1-AP targets AGBL3 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10592

  Product name: Recombinant human AGBL3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 272-621 aa of BC030651

  Sequence: QDGRHYFSLTWTFQFPHNKDTCYFAHCYPYTYTNLQEYLSGINNDPVRSKFCKIRVLCHTLARNMVYILTITTPLKNSDSRKRKAVILTARVHPGETNSSWIMKGFLDYILGNSSDAQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDLNRNYTSLLKESFPSVWYTRNMVHRLMEKREVILYCDLHGHSRKENIFMYGCDGSDRSKTLYLQQRIFPLMLSKNCPDKFSFSACKFNVQKSKEGTGRVVMWKMGIRNSFTMEATFCGSTLGNKRGTHFSTKDLESMGYHFCDSLLDYCDPDRTKYYRCLKELEEMERHITLEKVFEDSDTPVIDITLDVESRELTFLLR

• Full Name: ATP/GTP binding protein-like 3
• Calculated Molecular Weight: 73 kDa, 116 kDa
• Observed Molecular Weight: 73 kDa
• GenBank Accession Number: BC030651
• Gene Symbol: AGBL3
• Gene ID (NCBI): 340351
• RRID: AB_2878337
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NEM8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

AGBL3, also named as CCP3, is a metallocarboxypeptidase that may play a role in the processing of tubulin. AGBL3 has some isoforms with MW 107 kDA, 73 kDa, 116 kDa and 20 kDa.

Publications

What published studies show

The anti-BAP1 antibody (Cat# 16990-1-AP) has 1 total citation. It was published in Journal of Experimental Medicine (IF 11.6), where it was used by Western blot in mouse samples to study glutamylation of deubiquitinase BAP1 and its role in hematopoietic stem cell self-renewal and hematopoiesis. The research field encompasses stem cell biology and post-translational modification regulation.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	J Exp Med; Glutamylation of deubiquitinase BAP1 controls self-renewal of hematopoietic stem cells and hematopoiesis.; Authors - Zhen Xiong ; KO Validated