AGBL5/CCP5 Polyclonal antibody

• 

  WB analysis of recombinant protein using 15569-1-AP

  WB result of 15569-1-AP (anti-CCP5): Fusion protein expressed in Baculovirus.(From Dr. Jason Ford).

• 

  IHC staining of mouse cerebellum using 15569-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 15569-1-AP (AGBL5/CCP5 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse cerebellum using 15569-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 15569-1-AP (AGBL5/CCP5 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 15569-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 15569-1-AP (AGBL5/CCP5 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 15569-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 15569-1-AP (AGBL5/CCP5 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

AGBL5/CCP5 Polyclonal Antibody for WB, IF, IHC, ELISA

Cat No. 15569-1-AP

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

AGBL5, AGBL5/CCP5, ATP/GTP binding protein like 5, CCP5

---

Tested Applications

• Positive WB detected in: recombinant protein
• Positive IHC detected in: mouse cerebellum tissue, mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15569-1-AP targets AGBL5/CCP5 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7889

  Product name: Recombinant human AGBL5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 466-816 aa of BC007415

  Sequence: SLNSAHFDFQGCNFSEKNMYARDRRDGQSKEGSGRVAIYKASGIIHSYTLECNYNTGRSVNSIPAACHDNGRASPPPPPAFPSRYTVELFEQVGRAMAIAALDMAECNPWPRIVLSEHSSLTNLRAWMLKHVRNSRGLSSTLNVGVNKKRGLRTPPKSHNGLPVSCSENTLSRARSFSTGTSAGGSSSSQQNSPQMKNSPSFPFHGSRPAGLPGLGSSTQKVTHRVLGPVREPRSQDRRRQQQPLNHRPAGSLAPSPAPTSSGPASSHKLGSCLLPDSFNIPGSSCSLLSSGDKPEAVMVIGKGLLGTGARMPCIKTRLQTCPRRVSARRGPGFPRLGPGWAGAHRRLAEG

• Full Name: ATP/GTP binding protein-like 5
• Calculated Molecular Weight: 98 kDa
• GenBank Accession Number: BC007415
• Gene Symbol: AGBL5/CCP5
• Gene ID (NCBI): 60509
• RRID: AB_2878151
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NDL9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Jessica (Verified Customer) (10-21-2021)

U2OS cells transfected with a plasmid coding for CCP5-GFP Do not succed to have a nice signal for CCP5-GFP, nor for endogenous CCP5.

• Applications: Western Blot
• Primary Antibody Dilution: 1/1 000
• Cell Tissue Type: U2OS

AGBL5/CCP5 Antibody Western Blot validation (1/1 000 dilution) in U2OS (Cat no:15569-1-AP)