AGFG1 Polyclonal antibody

• 

  WB analysis of mouse testis using 12670-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 12670-1-AP (AGFG1 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  WB analysis of K-562 using 12670-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 12670-1-AP (AGFG1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HT-1080 using 12670-1-AP

  HT-1080 cells were subjected to SDS PAGE followed by western blot with 12670-1-AP (AGFG1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 12670-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 12670-1-AP (AGFG1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 12670-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 12670-1-AP (AGFG1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 12670-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 12670-1-AP (AGFG1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse testis using 12670-1-AP

  IP result of anti-AGFG1 (IP:12670-1-AP, 4ug; Detection:12670-1-AP 1:400) with mouse testis tissue lysate 4000ug.

• 

  IHC staining of human breast cancer using 12670-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 12670-1-AP (AGFG1 antibody) at dilution of 1:100 (under 10x lens).

AGFG1 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 12670-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IP, IF, IHC, ELISA

Synonyms

AGFG1, ArfGAP with FG repeats 1, HIV 1 Rev binding protein, HRB, Nucleoporin like protein RIP, RAB, Rev interacting protein, RIP

---

Tested Applications

• Positive WB detected in: mouse testis tissue, HeLa cells, HepG2 cells, HT-1080 cells, Jurkat cells, K-562 cells
• Positive IP detected in: mouse testis tissue
• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IF: See 1 publications below

Product Information

12670-1-AP targets AGFG1 in WB, IP, IF, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3352

  Product name: Recombinant human AGFG1 protein

  Source: e coli.-derived, PKG

  Tag: GST

  Domain: 4-303 aa of BC030592

  Sequence: SAKRKQEEKHLKMLRDMTGLPHNRKCFDCDQRGPTYVNMTVGSFVCTSCSGSLRGLNPPHRVKSISMTTFTQQEIEFLQKHGNEVCKQIWLGLFDDRSSAIPDFRDPQKVKEFLQEKYEKKRWYVPPEQAKVVASVHASISGSSASSTSSTPEVKPLKSLLGDSAPTLHLNKGTPSQSPVVGRSQGQQQEKKQFDLLSDLGSDIFAAPAPQSTATANFANFAHFNSHAAQNSANADFANFDAFGQSSGSSNFGGFPTASHSPFQPQTTGGSAASVNANFAHFDNFPKSSSADFGTFNTSQ

• Full Name: ArfGAP with FG repeats 1
• Calculated Molecular Weight: 562 aa, 58 kDa
• Observed Molecular Weight: 58 kDa
• GenBank Accession Number: BC030592
• Gene Symbol: AGFG1
• Gene ID (NCBI): 3267
• RRID: AB_2258077
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P52594
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IF	Cell; A Translation-Activating Function of MIWI/piRNA during Mouse Spermiogenesis.; Authors - Peng Dai
		Proc Natl Acad Sci U S A; Biogenesis of sperm acrosome is regulated by pre-mRNA alternative splicing of Acrbp in the mouse.; Authors - Yoshinori Kanemori