AGMAT Polyclonal antibody

• 

  WB analysis using 21899-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21899-1-AP (AGMAT antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 21899-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21899-1-AP (AGMAT antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human stomach cancer using 21899-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 21899-1-AP (AGMAT antibody) at dilution of 1:1600 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

AGMAT Polyclonal Antibody for WB, IHC, ELISA

Cat No. 21899-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

Agmatinase, Arginase, mitochondrial, Agmatine ureohydrolase

---

Tested Applications

• Positive WB detected in: mouse skeletal muscle tissue, rat skeletal muscle tissue
• Positive IHC detected in: human stomach cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000
• Immunohistochemistry (IHC): IHC : 1:800-1:3200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21899-1-AP targets AGMAT in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13609

  Product name: Recombinant human AGMAT protein

  Source: e coli.-derived, PKG

  Tag: GST

  Domain: 1-300 aa of BC005090

  Sequence: MLRLLASGCARGPGPGVGARPAAGLFHPGRRQSRQASDAPRNQPPSPEFVARPVGVCSMMRLPVQTSPEGLDAAFIGVPLDTGTSNRPGARFGPRRIREESVMLRTVNPSTGALPFQSLMVADLGDVNVNLYNLQDSCRRIQEAYEKIVAAGCIPLTLGGDHTITYPILQAMAKKHGPVGLLHVDAHTDTTDKALGEKLYHGAPFRRCVDEGLLDCKRVVQIGIRGSSTTLDPYRYNRSQGFRVVLAEDCWMKSLVPLMGEVRQQMGGKPIYISFDIDALDPAYAPGTGTPEIAGLTPSQ

• Full Name: agmatine ureohydrolase (agmatinase)
• Calculated Molecular Weight: 38 kDa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: BC005090
• Gene Symbol: AGMAT
• Gene ID (NCBI): 79814
• RRID: AB_3085677
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BSE5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

AGMAT is a metallohydrolase and belongs to the arginase family. AGMAT plays an important role in amino acid metabolism and can hydrolyze agmatine into urea and putrescine. AGMAT has been shown to play an important role in the development of tumors, including colorectal cancer, lung adenocarcinoma, and pancreatic adenocarcinoma(PMID: 36680755; PMID: 31699997; PMID: 35837051 ).