AGPAT3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• AGPAT3 Polyclonal antibody (25723-1-AP)

• Featured Product
• KD/KO Validated

AGPAT3 Polyclonal Antibody for WB, ELISA

Cat No. 25723-1-AP Copied!

Publications (6)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

1 AGP acyltransferase 3, 1 AGPAT 3, AGPAT3, LPAAT gamma, LPAAT GAMMA1

• 

  WB analysis of mouse testis using 25723-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 25723-1-AP (AGPAT3 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat testis using 25723-1-AP

  rat testis tissue were subjected to SDS PAGE followed by western blot with 25723-1-AP (AGPAT3 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for AGPAT3 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse testis tissue, rat testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25723-1-AP targets AGPAT3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22855

  Product name: Recombinant human AGPAT3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 326-376 aa of BC011971

  Sequence: VLGVFASGSPLLILTFLGFVGAASFGVRRLIGVTEIEKGSSYGNQEFKKKE

• Full Name: 1-acylglycerol-3-phosphate O-acyltransferase 3
• Calculated Molecular Weight: 376 aa, 43 kDa
• Observed Molecular Weight: 36-40 kDa
• GenBank Accession Number: BC011971
• Gene Symbol: AGPAT3
• Gene ID (NCBI): 56894
• RRID: AB_2880209
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NRZ7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The AGPAT3 antibody (Cat# 25723-1-AP) has 6 total citations across journals including Experimental Molecular Medicine, Journal for ImmunoTherapy of Cancer, Journal of Cachexia, Sarcopenia and Muscle, Investigative Ophthalmology & Visual Science, Oncology Research, and PLoS ONE. Research fields span ferroptosis susceptibility in gastric cancer, IFNγ-mediated immunotherapy, lipid metabolism in diabetic cardiomyopathy, glaucomatous optic nerve pathology, osteosarcoma immune microenvironment, and cisplatin resistance in ovarian carcinoma. All applications were Western blot.

Automatically generated from the 6 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Exp Mol Med; Helicobacter pylori CagA-mediated ether lipid biosynthesis promotes ferroptosis susceptibility in gastric cancer; Authors - Yanmei Peng ; KD Validated
human, mouse	WB	J Immunother Cancer; AGPAT3 reshapes tumor cell vulnerability to IFNγ-mediated ferroptosis and enhances immunotherapy efficacy through lipid remodeling.; Authors - Chuan Liu ; KD Validated
mouse	WB	J Cachexia Sarcopenia Muscle; Exogenous H2 S promotes ubiquitin-mediated degradation of SREBP1 to alleviate diabetic cardiomyopathy via SYVN1 S-sulfhydration; Authors - Shiwu Zhang
human	WB	Invest Ophthalmol Vis Sci; Alteration in Lysophospholipids and Converting Enzymes in Glaucomatous Optic Nerves.; Authors - Sasha M Milbeck
human	WB	Oncol Res; AGPAT3 Regulates Immune Microenvironment in Osteosarcoma via Lysophosphatidic Acid Metabolism.; Authors - Shenghui Su ; KD Validated
human	WB	PLoS One; Introduction of AGPAT3 gene as a regulator of cisplatin resistance in A2780 ovarian endometrioid carcinoma cell line; Authors - Hadi Alizadeh