Tested Applications
| Positive WB detected in | mouse testis tissue, rat testis tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 3 publications below |
| WB | See 6 publications below |
Product Information
25723-1-AP targets AGPAT3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag22855 Product name: Recombinant human AGPAT3 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 326-376 aa of BC011971 Sequence: VLGVFASGSPLLILTFLGFVGAASFGVRRLIGVTEIEKGSSYGNQEFKKKE Predict reactive species |
| Full Name | 1-acylglycerol-3-phosphate O-acyltransferase 3 |
| Calculated Molecular Weight | 376 aa, 43 kDa |
| Observed Molecular Weight | 36-40 kDa |
| GenBank Accession Number | BC011971 |
| Gene Symbol | AGPAT3 |
| Gene ID (NCBI) | 56894 |
| RRID | AB_2880209 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NRZ7 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for AGPAT3 antibody 25723-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Exp Mol Med Helicobacter pylori CagA-mediated ether lipid biosynthesis promotes ferroptosis susceptibility in gastric cancer
| ||
J Cachexia Sarcopenia Muscle Exogenous H2 S promotes ubiquitin-mediated degradation of SREBP1 to alleviate diabetic cardiomyopathy via SYVN1 S-sulfhydration | ||
Invest Ophthalmol Vis Sci Alteration in Lysophospholipids and Converting Enzymes in Glaucomatous Optic Nerves. | ||
J Immunother Cancer AGPAT3 reshapes tumor cell vulnerability to IFNγ-mediated ferroptosis and enhances immunotherapy efficacy through lipid remodeling.
| ||
Oncol Res AGPAT3 Regulates Immune Microenvironment in Osteosarcoma via Lysophosphatidic Acid Metabolism.
| ||
PLoS One Introduction of AGPAT3 gene as a regulator of cisplatin resistance in A2780 ovarian endometrioid carcinoma cell line |



