AGPAT4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• AGPAT4 Polyclonal antibody, PBS Only (16562-1-PBS)

• 

  WB analysis using 16562-1-AP (same clone as 16562-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 16562-1-AP (AGPAT4 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16562-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 16562-1-AP (same clone as 16562-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 16562-1-AP (AGPAT4 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16562-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 16562-1-AP (same clone as 16562-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 16562-1-AP (AGPAT4 antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16562-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 16562-1-AP (same clone as 16562-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 16562-1-AP (AGPAT4 antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16562-1-PBS in a different storage buffer formulation.

AGPAT4 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 16562-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

1 AGP acyltransferase 4, 1 AGPAT 4, 1 AGPAT4, 1-acylglycerol-3-phosphate O-acyltransferase 4, 1-acyl-sn-glycerol-3-phosphate acyltransferase delta

---

Product Information

16562-1-PBS targets AGPAT4 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9834

  Product name: Recombinant human AGPAT4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 24-300 aa of BC020209

  Sequence: SGLIINTIQLFTLLLWPINKQLFRKINCRLSYCISSQLVMLLEWWSGTECTIFTDPRAYLKYGKENAIVVLNHKFEIDFLCGWSLSERFGLLGGSKVLAKKELAYVPIIGWMWYFTEMVFCSRKWEQDRKTVATSLQHLRDYPEKYFFLIHCEGTRFTEKKHEISMQVARAKGLPRLKHHLLPRTKGFAITVRSLRNVVSAVYDCTLNFRNNENPTLLGVLNGKKYHADLYVRRIPLEDIPEDDDECSAWLHKLYQEKDAFQEEYYRTGTFPETPMV

• Full Name: 1-acylglycerol-3-phosphate O-acyltransferase 4 (lysophosphatidic acid acyltransferase, delta)
• Calculated Molecular Weight: 378 aa, 44 kDa
• Observed Molecular Weight: 44 kDa
• GenBank Accession Number: BC020209
• Gene Symbol: AGPAT4
• Gene ID (NCBI): 56895
• RRID: AB_3738377
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NRZ5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

AGPAT4 (Acylglycerophosphate acyltransferase 4), also known as LPAATδ (Lysophosphatidic acid acyltransferase delta), is a protein expressed mainly in brain and in muscle. AGPAT4 is characterized as a mitochondrial lysophosphatidic acid acyltransferase that regulates brain levels of phosphatidylcholine (PC), phosphatidylethanolamine (PE), and phosphatidylinositol (PI) (PMID: 28807933). AGPAT4 is relatively abundant in murine renal white adipose tissue (WAT) and has been linked to the regulation of TAG production, the differentiation of adipocytes, and the modulation of various pathologies including lipodystrophy, diabetes, and hepatic steatosis (PMID: 28814640).