AGXT2L2 Polyclonal antibody

• 

  WB analysis using 16449-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16449-1-AP (AGXT2L2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human prostate cancer using 16449-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 16449-1-AP (AGXT2L2 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human prostate cancer using 16449-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 16449-1-AP (AGXT2L2 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

AGXT2L2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 16449-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

PHYKPL, 5-phosphohydroxy-L-lysine phospho-lyase, Alanine--glyoxylate aminotransferase 2-like 2, EC:4.2.3.134, PP9286

---

Tested Applications

• Positive WB detected in: mouse heart tissue, rat heart
• Positive IHC detected in: human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16449-1-AP targets AGXT2L2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8391

  Product name: Recombinant human AGXT2L2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 276-450 aa of BC008009

  Sequence: MGKSIGNGHPVACVAATQPVARAFEATGVEYFNTFGGSPVSCAVGLAVLNVLEKEQLQDHATSVGSFLMQLLGQQKIKHPIVGDVRGVGLFIGVDLIKDEATRTPATEEAAYLVSRLKENYVLLSTDGPGRNILKFKPPMCFSLDNARQVVAKLDAILTDMEEKVRSCETLRLQP

• Full Name: alanine-glyoxylate aminotransferase 2-like 2
• Calculated Molecular Weight: 450aa,50 kDa; 175aa,19 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC008009
• Gene Symbol: AGXT2L2
• Gene ID (NCBI): 85007
• RRID: AB_2225868
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IUZ5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

AGXT2L2, also known as alanine-glyoxylate aminotransferase 2-like 2 or PHYKPL (5-phosphohydroxy-L-lysine phospho-lyase), is a nuclear gene encoding a mitochondrial enzyme. It belongs to the class-III pyridoxal phosphate-dependent aminotransferase family and shares approximately 36% sequence identity with AGXT2.