AHCTF1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• AHCTF1 Polyclonal antibody (30923-1-AP)

• 

  WB analysis using 30923-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30923-1-AP (AHCTF1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of A431 using 30923-1-AP

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using AHCTF1 antibody (30923-1-AP) at dilution of 1:800 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-phalloidin (red).

AHCTF1 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 30923-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

ELYS, TMBS62, MSTP108, MST108

---

Tested Applications

• Positive WB detected in: HeLa cells, A549 cells
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 1 publications below

Product Information

30923-1-AP targets AHCTF1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32788

  Product name: Recombinant human AHCTF1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2067-2266 aa of NM_001323342.1

  Sequence: ERTDEMTHKETNEQEERLLATASFTKSSRSSRTRSSKAILLPDLSEPNNEPLFSPASEVPRKAKAKKIEVPAQLKELVSDLSSQFVISPPALRSRQKNTSNKNKLEDELKDDAQSVETLGKPKAKRIRTSKTKQASKNTEKESAWSPPPIEIRLISPLASPADGVKSKPRKTTEVTGTGLGRNRKKLSSYPKQILRRKML

• Full Name: AT hook containing transcription factor 1
• Calculated Molecular Weight: 252 kDa
• Observed Molecular Weight: 270 kDa
• GenBank Accession Number: NM_001323342.1
• Gene Symbol: AHCTF1
• Gene ID (NCBI): 25909
• RRID: AB_3669786
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WYP5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

AHCTF1, also known as ELYS, TMBS62, is a large multifunctional protein. It plays essential roles in nuclear pore assembly and mitosis. AHCTF1 was expressed at higher levels in embryonic liver, spleen and thymus compared to the corresponding adult tissues (PMID: 11952839) and has 3 isoforms with MW of 252~256 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Dig Dis Sci; AHCTF1 Functions as an Oncogenic Factor and Promotes Tumor Progression in Hepatocellular Carcinoma; Authors - Huifang Liu ; KD Validated