AHSP Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• AHSP Polyclonal antibody, PBS Only (13643-1-PBS)

• 

  WB analysis using 13643-1-AP (same clone as 13643-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 13643-1-AP (AHSP antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13643-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 13643-1-AP (same clone as 13643-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 13643-1-AP (AHSP antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13643-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse lung using 13643-1-AP (same clone as 13643-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 13643-1-AP (AHSP antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13643-1-PBS in a different storage buffer formulation.

AHSP Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 13643-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, pig

Applications

WB, IHC, Indirect ELISA

Synonyms

ERAF, Erythroid-associated factor, Erythroid differentiation-related factor, erythroid associated factor, EDRF

---

Product Information

13643-1-PBS targets AHSP in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, pig samples.

• Tested Reactivity: human, mouse, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4588

  Product name: Recombinant human ERAF protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-102 aa of BC035842

  Sequence: MALLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKSHELPSHPPPSS

• Full Name: erythroid associated factor
• Calculated Molecular Weight: 102 aa, 12 kDa
• Observed Molecular Weight: 10 kDa
• GenBank Accession Number: BC035842
• Gene Symbol: AHSP
• Gene ID (NCBI): 51327
• RRID: AB_3669167
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NZD4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

AHSP acts as a chaperone to prevent the harmful aggregation of alpha-hemoglobin during normal erythroid cell development, and specifically protects free alpha-hemoglobin from precipitation. It is predicted to modulate pathological states of alpha-hemoglobin excess such as beta-thalassemia (PMID: 12066189).