Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

AIDA Polyclonal antibody

AIDA Polyclonal Antibody for WB, IHC, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF, IP, ELISA

Axin interaction partner and dorsalization antagonist, Axin interactor, dorsalization-associated protein, C1orf80

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for AIDA in ?

Tested Applications

Positive WB detected inHEK-293 cells, HeLa cells
Positive IP detected inHeLa cells
Positive IHC detected inmouse skeletal muscle tissue, human heart tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

23724-1-AP targets AIDA in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivitymouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag20588

Product name: Recombinant human AIDA protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-306 aa of BC015535

Sequence: MSEVTRSLLQRWGASFRRGADFDSWGQLVEAIDEYQILARHLQKEAQAQHNNSEFTEEQKKTIGKIATCLELRSAALQSTQSQEEFKLEDLKKLEPILKNILTYNKEFPFDVQPVPLRRILAPGEEENLEFEEDEEEGGAGAGSPDSFPARVPGTLLPRLPSEPGMTLLTIRIEKIGLKDAGQCIDPYITVSVKDLNGIDLTPVQDTPVASRKEDTYVHFNVDIELQKHVEKLTKGAAIFFEFKHYKPKKRFTSTKCFAFMEMDEIKPGPIVIELYKKPTDFKRKKLQLLTKKPLYLHLHQTLHKE

Predict reactive species
Full Name axin interactor, dorsalization associated
Calculated Molecular Weight 306 aa, 35 kDa
Observed Molecular Weight 35-40 kDa
GenBank Accession NumberBC015535
Gene Symbol AIDA
Gene ID (NCBI) 64853
RRIDAB_2879311
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ96BJ3
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

AIDA, also named as C1orf80, acts as a ventralizing factor during embryogenesis. It inhibits axin-mediated JNK activation by binding axin and disrupting axin homodimerization. It's highest expression in the heart and skeletal muscle. AIDA has three isoforms with MW 35 kDa, 16 kDa and 26 kDa.

Protocols

Product Specific Protocols
IHC protocol for AIDA antibody 23724-1-APDownload protocol
IP protocol for AIDA antibody 23724-1-APDownload protocol
WB protocol for AIDA antibody 23724-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The AIDA Polyclonal antibody (Cat# 23724-1-AP) has 2 citations. They appear in Cell Metabolism and Nature Cell Biology. The research fields include intestinal fat absorption and obesity prevention, as well as sympathetic innervation and adaptive thermogenesis via UCP1, both studied in mouse models using WB, IF, and IP applications.

SpeciesApplicationTitle
mouseWB,IF

Cell Metab

AIDA Selectively Mediates Downregulation of Fat Synthesis Enzymes by ERAD to Retard Intestinal Fat Absorption and Prevent Obesity.

Authors - Hui Luo
  • KO Validated
mouseIP

Nat Cell Biol

AIDA directly connects sympathetic innervation to adaptive thermogenesis by UCP1.

Authors - Meng Shi
  • KO Validated

Reviews

    1.0 out of 5
Add a review

1 verified customer reviews

What customers say

One reviewer (David G., Feb 2022) rated this product 1 star. Using lot 00023319 at a dilution of 10 µg/mL in a Luminex-based assay with human samples, they reported that the antibody-conjugated magnetic beads did not produce a strong signal, expressing disappointment with the performance.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


David (Verified Customer) (02-22-2022)

Unfortunately, the antibody-conjugated magnetic beads did not show a strong signal for the Luminex-based assay.

  • Applications: Other
  • Primary Antibody Dilution: 10ug/mL
  • Cell Tissue Type: Human
Loading...
||
New chat

Able™

正在加载,请稍候...