AIF Recombinant monoclonal antibody, PBS Only (Detector)

• 

  Sandwich ELISA standard curve of MP02287-2

  Sandwich ELISA standard curve of MP02287-2, Human AIF Recombinant Matched Antibody Pair - PBS only. 86156-2-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag13268. 86156-4-PBS was HRP conjugated as the detection antibody. Range: 0.313-20 ng/mL.

• 

  Sample test of MP02287-2

  The mean AIF concentration was determined to be 55.63 ng/mL in HeLa cell extract based on a 2.10 mg/mL extract load and 26.49 ng/mL in NIH/3T3 cell extract based on a 1.40 mg/mL extract load.

AIF Uni-rAb^® Recombinant Antibody for Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 86156-4-PBS

Clone No.250772B4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

AIFM1, Apoptosis-inducing factor 1, mitochondrial, EC:1.6.99.-, PDCD8

---

Product Information

86156-4-PBS targets AIF as part of a matched antibody pair:

MP02287-2: 86156-2-PBS capture and 86156-4-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag13268

  Product name: Recombinant human AIF protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 259-609 aa of BC111065

  Sequence: TPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSTPAVPQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHED

• Full Name: apoptosis-inducing factor, mitochondrion-associated, 1
• Calculated Molecular Weight: 609 aa, 66 kDa
• GenBank Accession Number: BC111065
• Gene Symbol: AIF
• Gene ID (NCBI): 9131
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O95831
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.