AIG1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• AIG1 Polyclonal antibody, PBS Only (14468-1-PBS)

• 

  WB analysis using 14468-1-AP (same clone as 14468-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 14468-1-AP (AIG1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14468-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat ovary using 14468-1-AP (same clone as 14468-1-PBS)

  rat ovary tissue were subjected to SDS PAGE followed by western blot with 14468-1-AP (AIG1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14468-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat heart using 14468-1-AP (same clone as 14468-1-PBS)

  rat heart tissue were subjected to SDS PAGE followed by western blot with 14468-1-AP (AIG1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14468-1-PBS in a different storage buffer formulation.

• 

  WB analysis of PC-3 using 14468-1-AP (same clone as 14468-1-PBS)

  PC-3 cells were subjected to SDS PAGE followed by western blot with 14468-1-AP (AIG1 Antibody) at dilution of 1:300 incubated at 4 degree celsius over night. This data was developed using the same antibody clone with 14468-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse testis using 14468-1-AP (same clone as 14468-1-PBS)

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 14468-1-AP (AIG1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14468-1-PBS in a different storage buffer formulation.

• 

  WB analysis of K-562 using 14468-1-AP (same clone as 14468-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 14468-1-AP (AIG1 Antibody) at dilution of 1:300 incubated at 4 degree celsius over night. This data was developed using the same antibody clone with 14468-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse heart using 14468-1-AP (same clone as 14468-1-PBS)

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 14468-1-AP (AIG1 Antibody) at dilution of 1:300 incubated at 4 degree celsius over night. This data was developed using the same antibody clone with 14468-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 14468-1-AP (same clone as 14468-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor using 14468-1-AP (AIG1 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 14468-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 14468-1-AP (same clone as 14468-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor using 14468-1-AP (AIG1 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 14468-1-PBS in a different storage buffer formulation.

AIG1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 14468-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

14468-1-PBS targets AIG1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5836

  Product name: Recombinant human AIG1 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 1-238 aa of BC025278

  Sequence: MALVPCQVLRMAILLSYCSILCNYKAIEMPSHQTYGGSWKFLTFIDLVIQAVFFGICVLTDLSSLLTRGSGNQEQERQLKKLISLRDWMLAVLAFPVGVFVVAVFWIIYAYDREMIYPKLLDNFIPGWLNHGMHTTVLPFILIEMRTSHHQYPSRSSGLTAICTFSVGYILWVCWVHHVTGMWVYPFLEHIGPGARIIFFGSTTILMNFLYLLGEVLNNYIWDTQKSMEEEKEKPKLE

• Full Name: androgen-induced 1
• Calculated Molecular Weight: 28 kDa
• Observed Molecular Weight: 28-32 kDa
• GenBank Accession Number: BC025278
• Gene Symbol: AIG1
• Gene ID (NCBI): 51390
• RRID: AB_2273794
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NVV5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.