AK2 Recombinant monoclonal antibody, PBS Only (Capture)

AK2 Uni-rAb® Recombinant Antibody for WB, IHC, Sandwich ELISA, Indirect ELISA
Cat No. 85406-3-PBS
Clone No.242899H7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Sandwich ELISA, Indirect ELISA

242899H7, adenylate kinase 2, Adenylate kinase 2, mitochondrial, N-terminally processed, Adenylate monophosphate kinase, ADK2

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85406-3-PBS targets AK2 as part of a matched antibody pair:

MP01927-3: 85406-3-PBS capture and 85406-2-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag1464

Product name: Recombinant human AK2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-202 aa of BC009405

Sequence: MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYR

Predict reactive species
Full Name adenylate kinase 2
Calculated Molecular Weight 26 kDa
Observed Molecular Weight 26 kDa
GenBank Accession NumberBC009405
Gene Symbol AK2
Gene ID (NCBI) 204
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP54819
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

AK2(Adenylate kinase 2, mitochondrial ) is also named as ADK2 and belongs to the adenylate kinase family. It plays a unique role in energy metabolism and energy transfer by regulating the ATP/ADP rate between the cytoplasma matrix and the mitochondria and it is increased expression during adipocyte and B cell differentiation(PMID:23020757). AK2 catalyzes the reversible transfer of a phosphoryl group from ATP to AMP(PMID:19043417). Defects in AK2 are the cause of reticular dysgenesis (RDYS)(PMID:19043416). It has 6 isoforms produced by alternative splicing.

Loading...
||
New chat Able
正在加载,请稍候...