AK2 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  WB analysis using 85406-3-RR (same clone as 85406-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85406-3-RR (AK2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85406-3-PBS in a different storage buffer formulation.

• 

  Sandwich ELISA sample test of MP01927-3

  The mean AK2 concentration was determined to be 6.31 ng/mL in HeLa cell extract based on a 2.10 mg/mL extract load and 5.60 ng/mL in HL-60 cell extract based on a 1.50 mg/mL extract load.

• 

  Sandwich ELISA standard curve of MP01927-3

  Sandwich ELISA standard curve of MP01927-3, Human AK2 Recombinant Matched Antibody Pair - PBS only. 85406-3-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag1464. 85406-2-PBS was HRP conjugated as the detection antibody. Range: 0.313-20 ng/mL.

• 

  IHC staining of mouse kidney using 85406-3-RR (same clone as 85406-3-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 85406-3-RR (AK2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85406-3-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 85406-3-RR (same clone as 85406-3-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 85406-3-RR (AK2 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85406-3-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 85406-3-RR

  Biolayer interferometry (BLl) kinetic assays of 85406-3-RR against Human AK2 were performed. The affinity constant is 0.428 nM.

AK2 Uni-rAb^® Recombinant Antibody for WB, IHC, Sandwich ELISA, Indirect ELISA

Cat No. 85406-3-PBS

Clone No.242899H7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Sandwich ELISA, Indirect ELISA

Synonyms

242899H7, adenylate kinase 2, Adenylate kinase 2, mitochondrial, N-terminally processed, Adenylate monophosphate kinase, ADK2

---

Product Information

85406-3-PBS targets AK2 as part of a matched antibody pair:

MP01927-3: 85406-3-PBS capture and 85406-2-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1464

  Product name: Recombinant human AK2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-202 aa of BC009405

  Sequence: MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYR

• Full Name: adenylate kinase 2
• Calculated Molecular Weight: 26 kDa
• Observed Molecular Weight: 26 kDa
• GenBank Accession Number: BC009405
• Gene Symbol: AK2
• Gene ID (NCBI): 204
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P54819
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

AK2(Adenylate kinase 2, mitochondrial ) is also named as ADK2 and belongs to the adenylate kinase family. It plays a unique role in energy metabolism and energy transfer by regulating the ATP/ADP rate between the cytoplasma matrix and the mitochondria and it is increased expression during adipocyte and B cell differentiation(PMID:23020757). AK2 catalyzes the reversible transfer of a phosphoryl group from ATP to AMP(PMID:19043417). Defects in AK2 are the cause of reticular dysgenesis (RDYS)(PMID:19043416). It has 6 isoforms produced by alternative splicing.