AK3 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 87090-3-RR (same clone as 87090-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87090-3-RR (AK3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87090-3-PBS in a different storage buffer formulation.

AK3 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 87090-3-PBS

Clone No.252261B9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

Adenylate kinase 3 alpha-like 1, AK 3, AK3L1, AK6, AKL3L

---

Product Information

87090-3-PBS targets AK3 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag3146

  Product name: Recombinant human AK3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-227 aa of BC013771

  Sequence: MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGTEIGVLAKAFIDQGKLIPDDVMTRLALHELKNLTQYSWLLDGFPRTLPQAEALDRAYQIDTVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEDQTKPVLEYYQKKGVLETFSGTETNKIWPYVYAFLQTKVPQRSQKASVTP

• Full Name: adenylate kinase 3
• Calculated Molecular Weight: 227 aa, 26 kDa
• Observed Molecular Weight: 26-30 kDa
• GenBank Accession Number: BC013771
• Gene Symbol: AK3
• Gene ID (NCBI): 50808
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9UIJ7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

AK3(Adenylate kinase 3) is also named as AK3L1, AK6, AKL3L and belongs to the adenylate kinase family. It is located in the mitochondrial matrix and is a GTP:AMP phosphotransferase(PMID:2546792).