AK6 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• AK6 Polyclonal antibody, PBS Only (30517-1-PBS)

• 

  WB analysis using 30517-1-AP (same clone as 30517-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30517-1-AP (AK6 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30517-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 30517-1-AP (same clone as 30517-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 30517-1-AP (AK6 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30517-1-PBS in a different storage buffer formulation.

AK6 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 30517-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

Adenylate kinase isoenzyme 6, CINAP, KAD6

---

Product Information

30517-1-PBS targets AK6 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29330

  Product name: Recombinant human AK6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-172 aa of NM_016283.4

  Sequence: MLLPNILLTGTPGVGKTTLGKELASKSGLKYINVGDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVDYHGCDFFPERWFHIVFVLRTDTNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQILKWIEQWIKDHNS

• Full Name: AK6
• Calculated Molecular Weight: 20 kDa
• Observed Molecular Weight: 20-24 kDa
• GenBank Accession Number: NM_016283.4
• Gene Symbol: AK6
• Gene ID (NCBI): 102157402
• RRID: AB_3742347
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y3D8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Adenylate Kinase 6 (AK6), also known as human coilin-interacting nuclear ATPase protein (hCINAP), is a unique enzyme that belongs to the adenylate kinase family. It is encoded by the AK6 gene located on chromosome 5q13.2. AK6 is a dual-activity enzyme, possessing both adenylate kinase and ATPase activities. The protein is involved in various biological processes, including gene transcription, ribosome quality control, embryonic development, cellular senescence, metabolism, proliferation, apoptosis, DNA damage response, and inflammation. It is also implicated in tumor development and has been explored as a potential drug target for cancer and neurodegenerative diseases.