AKAP10 Polyclonal antibody

• 

  WB analysis using 12356-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12356-1-AP (AKAP10 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 12356-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 12356-1-AP (AKAP10 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon cancer using 12356-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 12356-1-AP (AKAP10 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 12356-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 12356-1-AP (AKAP10 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lymphoma using 12356-1-AP

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 12356-1-AP (AKAP10 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lymphoma using 12356-1-AP

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 12356-1-AP (AKAP10 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

AKAP10 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 12356-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

AKAP 10, AKAP10, D AKAP 2, D AKAP2, PRKA10

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells, Jurkat cells
• Positive IHC detected in: human colon cancer tissue, human lymphoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

12356-1-AP targets AKAP10 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3020

  Product name: Recombinant human AKAP10 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 314-663 aa of BC017055

  Sequence: IPITEAMRNDIIARICGEDGQVDPNCFVLAQSIVFSAMEQEHFSEFLRSHHFCKYQIEVLTSGTVYLADILFCESALFYFSEYMEKEDAVNILQFWLAADNFQSQLAAKKGQYDGQEAQNDAMILYDKYFSLQATHPLGFDDVVRLEIESNICREGGPLPNCFTTPLRQAWTTMEKVFLPGFLSSNLYYKYLNDLIHSVRGDEFLGGNVSLTAPGSVGPPDESHPGSSDSSASQSSVKKASIKILKNFDEAIIVDAASLDPESLYQRTYAGKMTFGRVSDLGQFIRESEPEPDVRKSKGSMFSQAMKKWVQGNTDEAQEELAWKIAKMIVSDIMQQAQYDQPLEKSTKL

• Full Name: A kinase (PRKA) anchor protein 10
• Calculated Molecular Weight: 662 aa, 74 kDa
• Observed Molecular Weight: 74 kDa
• GenBank Accession Number: BC017055
• Gene Symbol: AKAP10
• Gene ID (NCBI): 11216
• RRID: AB_2225588
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43572
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Med Chem; Discovery of a Novel Small-Molecule Inhibitor Disrupting TRBP-Dicer Interaction against Hepatocellular Carcinoma via the Modulation of microRNA Biogenesis.; Authors - Ting Peng