AKR1C3 Recombinant monoclonal antibody, PBS Only

• 

  Affinity and Kinetic Characterization of 84872-2-PBS

  Biolayer interferometry (BLl) kinetic assay of 84872-2-PBS against Human AKR1C3 was performed. The affinity constant is 4.49 nM.

AKR1C3 Uni-rAb^® Recombinant Antibody for Indirect ELISA

Cat No. 84872-2-PBS

Clone No.242222B1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Indirect ELISA

Synonyms

17-beta-HSD 5, 17-beta-hydroxysteroid dehydrogenase type 5, 3-alpha-HSD type 2, 3-alpha-HSD type II, brain, 3-alpha-hydroxysteroid dehydrogenase type 2

---

Product Information

84872-2-PBS targets AKR1C3 in Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1674

  Product name: Recombinant human AKR1C3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-323 aa of BC019230

  Sequence: MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEY

• Full Name: aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II)
• Calculated Molecular Weight: 323 aa, 37 kDa
• GenBank Accession Number: BC019230
• Gene Symbol: AKR1C3
• Gene ID (NCBI): 8644
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P42330
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.