AKR7A2 Polyclonal antibody

• 

  WB analysis of HEK-293 using 10730-1-AP

  WB result of AKR7A2 antibody (10730-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-AKR7A2 transfected HEK-293 cells.

• 

  WB analysis of mouse liver using 10730-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 10730-1-AP (AKR7A2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 10730-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 10730-1-AP (AKR7A2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A431 using 10730-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 10730-1-AP (AKR7A2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver cancer using 10730-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 10730-1-AP (AKR7A2 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 10730-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 10730-1-AP (AKR7A2 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

AKR7A2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 10730-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

AFAR, AFAR1, AFB1 aldehyde reductase 1, AFB1 AR 1, AFB1 AR1, AKR7, AKR7A2, Aldoketoreductase 7, SSA reductase

---

Tested Applications

• Positive WB detected in: mouse liver tissue, HepG2 cells, A431 cells, HEK-293 cells
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:100-1:400

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IHC: See 1 publications below

Product Information

10730-1-AP targets AKR7A2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1049

  Product name: Recombinant human AKR7A2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 60-359 aa of BC007352

  Sequence: RAFLERGHTELDTAFMYSDGQSETILGGLGLGLGGGDCRVKIATKANPWDGKSLKPDSVRSQLETSLKRLQCPQVDLFYLHAPDHGTPVEETLHACQRLHQEGKFVELGLSNYASWEVAEICTLCKSNGWILPTVYQGMYNATTRQVETELFPCLRHFGLRFYAYNPLAGGLLTGKYKYEDKDGKQPVGRFFGNSWAETYRNRFWKEHHFEAIALVEKALQAAYGASAPSVTSAALRWMYHHSQLQGAHGDAVILGMSSLEQLEQNLAATEEGPLEPAVVDAFNQAWHLVAHECPNYFR

• Full Name: aldo-keto reductase family 7, member A2 (aflatoxin aldehyde reductase)
• Calculated Molecular Weight: 40 kDa
• Observed Molecular Weight: 35-40 kDa
• GenBank Accession Number: BC007352
• Gene Symbol: AKR7A2
• Gene ID (NCBI): 8574
• RRID: AB_2224439
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43488
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

AKR7A2(Aflatoxin B1 aldehyde reductase member 2) is also named as AFAR, AFAR1, AKR7 and belongs to the aldo/keto reductase family. AKR7A2 enzyme is catalytically active toward aldehydes arising from lipid peroxidation, suggesting a potential role against the consequences of oxidative stress, and representing an important detoxication route in mammalian cells (PMID:22001351).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Environ Toxicol; Naringin alleviates acetaminophen-induced acute liver injury by activating Nrf2 via CHAC2 upregulation.; Authors - Xiaohan Zhai
human	WB,IHC	Pancreatology; Proteomic analysis of pancreatic ductal adenocarcinoma compared with normal adjacent pancreatic tissue and pancreatic benign cystadenoma.; Authors - Cui Yazhou Y