AKR7A2 Monoclonal antibody, PBS Only

• 

  WB analysis of Jurkat using 66677-1-Ig (same clone as 66677-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 66677-1-Ig (AKR7A2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66677-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 66677-1-Ig (same clone as 66677-1-PBS)

  WB result of AKR7A2 antibody (66677-1-Ig; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-AKR7A2 transfected HEK-293 cells. This data was developed using the same antibody clone with 66677-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 66677-1-Ig (same clone as 66677-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 66677-1-Ig (AKR7A2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66677-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 66677-1-Ig (same clone as 66677-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66677-1-Ig (AKR7A2 antibody) at dilution of 1:300 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66677-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 66677-1-Ig (same clone as 66677-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66677-1-Ig (AKR7A2 antibody) at dilution of 1:300 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66677-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 66677-1-Ig (same clone as 66677-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using AKR7A2 antibody (66677-1-Ig, Clone: 2E1E8 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66677-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

AKR7A2 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 66677-1-PBS

Clone No.2E1E8

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

AFAR, AFAR1, AFB1 aldehyde reductase 1, AFB1 AR 1, AFB1 AR1, AKR7, AKR7A2, Aldoketoreductase 7, SSA reductase

---

Product Information

66677-1-PBS targets AKR7A2 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26105

  Product name: Recombinant human AKR7A2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 60-359 aa of BC007352

  Sequence: RAFLERGHTELDTAFMYSDGQSETILGGLGLGLGGGDCRVKIATKANPWDGKSLKPDSVRSQLETSLKRLQCPQVDLFYLHAPDHGTPVEETLHACQRLHQEGKFVELGLSNYASWEVAEICTLCKSNGWILPTVYQGMYNATTRQVETELFPCLRHFGLRFYAYNPLAGGLLTGKYKYEDKDGKQPVGRFFGNSWAETYRNRFWKEHHFEAIALVEKALQAAYGASAPSVTSAALRWMYHHSQLQGAHGDAVILGMSSLEQLEQNLAATEEGPLEPAVVDAFNQAWHLVAHECPNYFR

• Full Name: aldo-keto reductase family 7, member A2 (aflatoxin aldehyde reductase)
• Calculated Molecular Weight: 40 kDa
• Observed Molecular Weight: 35-40 kDa
• GenBank Accession Number: BC007352
• Gene Symbol: AKR7A2
• Gene ID (NCBI): 8574
• RRID: AB_2882031
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O43488
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

AKR7A2(Aflatoxin B1 aldehyde reductase member 2) is also named as AFAR, AFAR1, AKR7 and belongs to the aldo/keto reductase family. AKR7A2 enzyme is catalytically active toward aldehydes arising from lipid peroxidation, suggesting a potential role against the consequences of oxidative stress, and representing an important detoxication route in mammalian cells(PMID:22001351).