ALAD Polyclonal antibody

• 

  WB analysis using 31686-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31686-1-AP (ALAD antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

ALAD Polyclonal Antibody for WB, ELISA

Cat No. 31686-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

ALADH, Porphobilinogen synthase, Delta aminolevulinic acid dehydratase

---

Tested Applications

• Positive WB detected in: Jurkat cells, U-251 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

31686-1-AP targets ALAD in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35649

  Product name: Recombinant human ALAD protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 151-330 aa of NM_000031.5

  Sequence: AEVALAYAKAGCQVVAPSDMMDGRVEAIKEALMAHGLGNRVSVMSYSAKFASCFYGPFRDAAKSSPAFGDRRCYQLPPGARGLALRAVDRDVREGADMLMVKPGMPYLDIVREVKDKHPDLPLAVYHVSGEFAMLWHGAQAGAFDLKAAVLEAMTAFRRAGADIIITYYTPQLLQWLKEE

• Full Name: aminolevulinate, delta-, dehydratase
• Calculated Molecular Weight: 36kDa，330aa
• Observed Molecular Weight: 36-39 kDa
• GenBank Accession Number: NM_000031.5
• Gene Symbol: ALAD
• Gene ID (NCBI): 210
• RRID: AB_3670079
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P13716
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Delta-aminolevulinic acid dehydratase (ALAD) is also named as Porphobilinogen synthase. ALAD, encoded by the moonlighting gene ALAD, not only participates in the second step of heme biosynthesis, but also inhibits the 26S proteasome (PMID: 35318110). ALAD is involved in tumor progression. For example, ALAD2 allele (ALAD polymorphism) is related to an increased risk for meningioma, and downregulation of ALAD is related to poor prognosis of patients with breast cancer (PMID: 16140629, PMID: 28403546).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Rep; An updated inventory of genes essential for oxidative phosphorylation identifies a mitochondrial origin in familial Ménière's disease; Authors - Marcell Harhai