ALDH1B1 Recombinant monoclonal antibody, PBS Only (Detector)

ALDH1B1 Uni-rAb® Recombinant Antibody for WB, IHC, Cytometric bead array, Sandwich ELISA, Indirect ELISA
Cat No. 85426-2-PBS
Clone No.242944E7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Cytometric bead array, Sandwich ELISA, Indirect ELISA

Aldehyde dehydrogenase 5, Aldehyde dehydrogenase X, mitochondrial, ALDH5, ALDHX, EC:1.2.1.3

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85426-2-PBS targets ALDH1B1 as part of a matched antibody pair:

MP01995-1: 85426-1-PBS capture and 85426-2-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag7144

Product name: Recombinant human ALDH1B1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 168-517 aa of BC001619

Sequence: FCFTRHEPVGVCGQIIPWNFPLVMQGWKLAPALATGNTVVMKVAEQTPLSALYLASLIKEAGFPPGVVNIITGYGPTAGAAIAQHMDVDKVAFTGSTEVGHLIQKAAGDSNLKRVTLELGGKSPSIVLADADMEHAVEQCHEALFFNMGQCCCAGSRTFVEESIYNEFLERTVEKAKQRKVGNPFELDTQQGPQVDKEQFERVLGYIQLGQKEGAKLLCGGERFGERGFFIKPTVFGGVQDDMRIAKEEIFGPVQPLFKFKKIEEVVERANNTRYGLAAAVFTRDLDKAMYFTQALQAGTVWVNTYNIVTCHTPFGGFKESGNGRELGEDGLKAYTEVKTVTIKVPQKNS

Predict reactive species
Full Name aldehyde dehydrogenase 1 family, member B1
Calculated Molecular Weight 57 kDa
Observed Molecular Weight50-55 kDa
GenBank Accession NumberBC001619
Gene Symbol ALDH1B1
Gene ID (NCBI) 219
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP30837
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Aldehyde dehydrogenases (ALDHs) belong to a superfamily of NAD(P)+-dependent enzymes, which catalyze the oxidation of endogenous and exogenous aldehydes to their corresponding acids. ALDH1B1 is a mitochondrial ALDH that it is dramatically upregulated in human colonic adenocarcinoma, making it a potential biomarker for human colon cancer.(PMID:21216231). ALDH1B1 is a homotetramer expressed in various adult and fetal human tissues including liver, testis, kidney, skeletal muscle, heart, placenta, brain and lung(PMID:18611112).

Loading...
||
New chat Able
正在加载,请稍候...