ALDH1B1 Recombinant monoclonal monoclonal antibody

ALDH1B1 Uni-rAb® Recombinant Antibody for WB, ELISA
Cat No. 85426-4-RR
Clone No.242944D1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

242944D1, Aldehyde dehydrogenase 5, Aldehyde dehydrogenase X, mitochondrial, ALDH5, ALDHX

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inK-562 cells, HepG2 cells, HL-60 cells, mouse brain tissue, rat brain tissue, human testis tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

85426-4-RR targets ALDH1B1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag7144

Product name: Recombinant human ALDH1B1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 168-517 aa of BC001619

Sequence: FCFTRHEPVGVCGQIIPWNFPLVMQGWKLAPALATGNTVVMKVAEQTPLSALYLASLIKEAGFPPGVVNIITGYGPTAGAAIAQHMDVDKVAFTGSTEVGHLIQKAAGDSNLKRVTLELGGKSPSIVLADADMEHAVEQCHEALFFNMGQCCCAGSRTFVEESIYNEFLERTVEKAKQRKVGNPFELDTQQGPQVDKEQFERVLGYIQLGQKEGAKLLCGGERFGERGFFIKPTVFGGVQDDMRIAKEEIFGPVQPLFKFKKIEEVVERANNTRYGLAAAVFTRDLDKAMYFTQALQAGTVWVNTYNIVTCHTPFGGFKESGNGRELGEDGLKAYTEVKTVTIKVPQKNS

Predict reactive species
Full Name aldehyde dehydrogenase 1 family, member B1
Calculated Molecular Weight 57 kDa
Observed Molecular Weight 55 kDa
GenBank Accession NumberBC001619
Gene Symbol ALDH1B1
Gene ID (NCBI) 219
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP30837
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Aldehyde dehydrogenases (ALDHs) belong to a superfamily of NAD(P)+-dependent enzymes, which catalyze the oxidation of endogenous and exogenous aldehydes to their corresponding acids. ALDH1B1 is a mitochondrial ALDH that it is dramatically upregulated in human colonic adenocarcinoma, making it a potential biomarker for human colon cancer.(PMID:21216231). ALDH1B1 is a homotetramer expressed in various adult and fetal human tissues including liver, testis, kidney, skeletal muscle, heart, placenta, brain and lung(PMID:18611112). This antibody is specific to ALDH1B1.

Protocols

Product Specific Protocols
WB protocol for ALDH1B1 antibody 85426-4-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...