ALDH5A1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ALDH5A1 Polyclonal antibody (17319-1-AP)

• Featured Product
• KD/KO Validated

ALDH5A1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 17319-1-AP Copied!

Publications (8)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

EC:1.2.1.24, NAD(+)-dependent succinic semialdehyde dehydrogenase, SSADH, SSDH, Succinate-semialdehyde dehydrogenase, mitochondrial

• 

  WB analysis of HepG2 using 17319-1-AP

  WB result of ALDH5A1 antibody (17319-1-AP; 1:30000; incubated at room temperature for 1.5 hours) with sh-Control and sh-ALDH5A1 transfected HepG2 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 17319-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17319-1-AP (ALDH5A1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 17319-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17319-1-AP (ALDH5A1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 17319-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 17319-1-AP (ALDH5A1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 17319-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 17319-1-AP (ALDH5A1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 17319-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 17319-1-AP (ALDH5A1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 17319-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 17319-1-AP (ALDH5A1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 17319-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 17319-1-AP (ALDH5A1 Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 17319-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 17319-1-AP (ALDH5A1 Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of A431 using 17319-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed A431 cells using 17319-1-AP (ALDH5A1 antibody) at dilution of 1:100 and CoraLite488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ALDH5A1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: rat brain tissue, HepG2 cells, mouse liver tissue
• Positive IHC detected in: human liver cancer tissue, human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17319-1-AP targets ALDH5A1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11293

  Product name: Recombinant human ALDH5A1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 175-535 aa of BC034321

  Sequence: YGDIIHTPAKDRRALVLKQPIGVAAVITPWNFPSAMITRKVGAALAAGCTVVVKPAEDTPFSALALAELASQAGIPSGVYNVIPCSRKNAKEVGEAICTDPLVSKISFTGSTTTGKILLHHAANSVKRVSMELGGLAPFIVFDSANVDQAVAGAMASKFRNTGQTCVCSNQFLVQRGIHDAFVKAFAEAMKKNLRVGNGFEEGTTQGPLINEKAVEKVEKQVNDAVSKGATVVTGGKRHQLGKNFFEPTLLCNVTQDMLCTHEETFGPLAPVIKFDTEEEAIAIANAADVGLAGYFYSQDPAQIWRVAEQLEVGMVGVNEGLISSVECPFGGVKQSGLGREGSKYGIDEYLELKYVCYGGL

• Full Name: aldehyde dehydrogenase 5 family, member A1
• Calculated Molecular Weight: 535 aa, 57 kDa
• Observed Molecular Weight: 51-59 kDa
• GenBank Accession Number: BC034321
• Gene Symbol: ALDH5A1
• Gene ID (NCBI): 7915
• RRID: AB_2224478
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P51649
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

ALDH5A1 Polyclonal antibody (Cat# 17319-1-AP) has 8 citations published in journals including Journal of Ethnopharmacology, Ecotoxicology and Environmental Safety, Cancer Biology & Therapy, Scientific Reports, Neuropharmacology, Biomedical Reports, Aging, and Cell Death & Differentiation. Research fields span hepatotoxicity, neurotoxicity and cognitive dysfunction, ovarian cancer prognosis, renal cell carcinoma, ketamine's antidepressant mechanism, osteonecrosis of the femoral head, ulcerative colitis immune landscape, and ferroptosis-mediated tumour development.

Automatically generated from the 8 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	J Ethnopharmacol; Multi-omics and chemical profiling approaches to understand the material foundation and pharmacological mechanism of Sophorae Tonkinensis Radix et Rhizome-induced liver injury in mice; Authors - Si-Wei Rao
mouse	WB	Ecotoxicol Environ Saf; 1,2-Dichloroethane causes anxiety and cognitive dysfunction in mice by disturbing GABA metabolism and inhibiting the cAMP-PKA-CREB signaling pathway; Authors - Yuchen Qin
human	IHC	Cancer Biol Ther; Decreased expression of ALDH5A1 predicts prognosis in patients with ovarian cancer.; Authors - Xun Tian
human	WB	Sci Rep; Identifying ADME-related gene signature for immune landscape and prognosis in KIRC by single-cell and spatial transcriptome analysis; Authors - Hongyun Wang
mouse	WB	Neuropharmacology; A role of GABAA receptor α1 subunit in the hippocampus for rapid-acting antidepressant-like effects of ketamine; Authors - Xiao-Hui Tang
human	WB,IF	Biomed Rep; ALDH5A1 as a key in osteonecrosis of the femoral head: Insights from bioinformatics and experimental validation.; Authors - Tianyu Ren