ALDH9A1 Polyclonal antibody

• 

  WB analysis of NIH/3T3 using 26621-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 26621-1-AP (ALDH9A1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 26621-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 26621-1-AP (ALDH9A1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver cancer using 26621-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 26621-1-AP (ALDH9A1 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 26621-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 26621-1-AP (ALDH9A1 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 26621-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 26621-1-AP (ALDH9A1 Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human kidney using 26621-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 26621-1-AP (ALDH9A1 Antibody) at dilution of 1:200 (under 40x lens).

• 

  IF Staining of HeLa using 26621-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using ALDH9A1 antibody (26621-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2).

ALDH9A1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 26621-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

EC:1.2.1.19, ALDH9, ALDH7, ALDH4, 4-trimethylaminobutyraldehyde dehydrogenase, N-terminally processed

---

Tested Applications

• Positive WB detected in: NIH/3T3 cells, HEK-293 cells
• Positive IHC detected in: human liver cancer tissue, human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:100-1:400
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 3 publications below
• IHC: See 1 publications below

Product Information

26621-1-AP targets ALDH9A1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24312

  Product name: Recombinant human ALDH9A1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 285-412 aa of BC151140

  Sequence: LIIFSDCDMNNAVKGALMANFLTQGQVCCNGTRVFVQKEILDKFTEEVVKQTQRIKIGDPLLEDTRMGPLINRPHLERVLGFVKVAKEQGAKVLCGGDIYVPEDPKLKDGYYMRPCVLTNCRDDMTCV

• Full Name: aldehyde dehydrogenase 9 family, member A1
• Calculated Molecular Weight: 518 aa, 56 kDa
• Observed Molecular Weight: 46 kDa
• GenBank Accession Number: BC151140
• Gene Symbol: ALDH9A1
• Gene ID (NCBI): 223
• RRID: AB_2880577
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P49189
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Aldehyde dehydrogenase 9 family member A1(ALDH9A1), belongs to the aldehyde dehydrogenase family of proteins. ALDH9A1 has a high activity for oxidation of gamma-aminobutyraldehyde and other amino aldehydes. ALDH9A1 catalyzes the dehydrogenation of gamma-aminobutyraldehyde to gamma-aminobutyric acid. ALDH9A1 has 3 isoforms with the molecular mass of 46-56 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cancers (Basel); Mitochondrial Protein Cox7b Is a Metabolic Sensor Driving Brain-Specific Metastasis of Human Breast Cancer Cells; Authors - Marine C N M Blackman
human	WB	Proteomes; Utilizing Optimized Tools to Investigate PTM Crosstalk: Identifying Potential PTM Crosstalk of Acetylated Mitochondrial Proteins.; Authors - Henrick Horita
human	WB,IHC	Mol Carcinog; C1QBP Promotes Prostate Cancer Progression and Lipid Accumulation by Negatively Regulating ALDH9A1; Authors - Xinyu Liu ; KD Validated