Tested Applications
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL594-67372 targets ALDH9A1 in IF/ICC applications and shows reactivity with Human samples.
| Tested Reactivity | Human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24493 Product name: Recombinant human ALDH9A1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 285-412 aa of BC151140 Sequence: LIIFSDCDMNNAVKGALMANFLTQGQVCCNGTRVFVQKEILDKFTEEVVKQTQRIKIGDPLLEDTRMGPLINRPHLERVLGFVKVAKEQGAKVLCGGDIYVPEDPKLKDGYYMRPCVLTNCRDDMTCV Predict reactive species |
| Full Name | aldehyde dehydrogenase 9 family, member A1 |
| Calculated Molecular Weight | 518 aa, 56 kDa |
| Observed Molecular Weight | 46 kDa |
| GenBank Accession Number | BC151140 |
| Gene Symbol | ALDH9A1 |
| Gene ID (NCBI) | 223 |
| RRID | AB_2920122 |
| Conjugate | CoraLite®594 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 588 nm / 604 nm |
| Excitation Laser | Yellow-Green Laser (561 nm) |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P49189 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Aldehyde dehydrogenase 9 family member A1(ALDH9A1), belongs to the aldehyde dehydrogenase family of proteins. ALDH9A1 has a high activity for oxidation of gamma-aminobutyraldehyde and other amino aldehydes. ALDH9A1 catalyzes the dehydrogenation of gamma-aminobutyraldehyde to gamma-aminobutyric acid. ALDH9A1 has 3 isoforms with the molecular mass of 46-56 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL594 ALDH9A1 antibody CL594-67372 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

