CoraLite® Plus 488-conjugated ALDH9A1 Monoclonal antibody

• 

  IF Staining of HeLa using CL488-67372

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using CoraLite® Plus 488 ALDH9A1 antibody (CL488-67372, Clone: 3C5C9 ) at dilution of 1:100.

ALDH9A1 Monoclonal Antibody for IF/ICC

Cat No. CL488-67372

Clone No.3C5C9

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

IF/ICC

Synonyms

ALDH4, ALDH7, ALDH9, ALDH9A1, E3, TMABADH

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67372 targets ALDH9A1 in IF/ICC applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24493

  Product name: Recombinant human ALDH9A1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 285-412 aa of BC151140

  Sequence: LIIFSDCDMNNAVKGALMANFLTQGQVCCNGTRVFVQKEILDKFTEEVVKQTQRIKIGDPLLEDTRMGPLINRPHLERVLGFVKVAKEQGAKVLCGGDIYVPEDPKLKDGYYMRPCVLTNCRDDMTCV

• Full Name: aldehyde dehydrogenase 9 family, member A1
• Calculated Molecular Weight: 518 aa, 56 kDa
• Observed Molecular Weight: 46 kDa
• GenBank Accession Number: BC151140
• Gene Symbol: ALDH9A1
• Gene ID (NCBI): 223
• RRID: AB_2919459
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P49189
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Aldehyde dehydrogenase 9 family member A1(ALDH9A1), belongs to the aldehyde dehydrogenase family of proteins. ALDH9A1 has a high activity for oxidation of gamma-aminobutyraldehyde and other amino aldehydes. ALDH9A1 catalyzes the dehydrogenation of gamma-aminobutyraldehyde to gamma-aminobutyric acid. ALDH9A1 has 3 isoforms with the molecular mass of 46-56 kDa.