ALG11 Polyclonal antibody

• 

  WB analysis of mouse brain using 27085-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 27085-1-AP (ALG11 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat brain using 27085-1-AP

  rat brain tissue were subjected to SDS PAGE followed by western blot with 27085-1-AP (ALG11 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 27085-1-AP

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 27085-1-AP (ALG11 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

ALG11 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27085-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

KIAA0266, GT8, Glycolipid 2-alpha-mannosyltransferase, GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase, EC:2.4.1.131

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue
• Positive IHC detected in: human intrahepatic cholangiocarcinoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27085-1-AP targets ALG11 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21123

  Product name: Recombinant human ALG11 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 35-363 aa of BC010857

  Sequence: LMQCVPDVYIDSMGYAFTLPLFKYIGGCQVGSYVHYPTISTDMLSVVKNQNIGFNNAAFITRNPFLSKVKLIYYYLFAFIYGLVGSCSDVVMVNSSWTLNHILSLWKVGNCTNIVYPPCDVQTFLDIPLHEKKMTPGHLLVSVGQFRPEKNHPLQIRAFAKLLNKKMVESPPSLKLVLIGGCRNKDDELRVNQLRRLSEDLGVQEYVEFKINIPFDELKNYLSEATIGLHTMWNEHFGIGVVECMAAGTIILAHNSGGPKLDIVVPHEGDITGFLAESEEDYAETIAHILSMSAEKRLQIRKSARASVSRFSDQEFEVTFLSSVEKLFK

• Full Name: asparagine-linked glycosylation 11, alpha-1,2-mannosyltransferase homolog (yeast)
• Calculated Molecular Weight: 328 aa, 37 kDa
• Observed Molecular Weight: 50 kDa~56 kDa
• GenBank Accession Number: BC010857
• Gene Symbol: ALG11
• Gene ID (NCBI): 440138
• RRID: AB_2880750
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q2TAA5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.