ALG13 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ALG13 Polyclonal antibody (28738-1-AP)

ALG13 Polyclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 28738-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF-P, ELISA

Synonyms

Asparagine-linked glycosylation 13 homolog, CXorf45, EC:2.4.1.141, GLT28D1, Glycosyltransferase 28 domain-containing protein 1

• 

  WB analysis using 28738-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 28738-1-AP (ALG13 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 28738-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 28738-1-AP (ALG13 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 28738-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 28738-1-AP (ALG13 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse brain using 28738-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using ALG13 antibody (28738-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ALG13 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Jurkat cells
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28738-1-AP targets ALG13 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30299

  Product name: Recombinant human ALG13 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 45-127 aa of BC005336

  Sequence: TVVPEPFSTESFTLDVYRYKDSLKEDIQKADLVISHAGAGSCLETLEKGKPLVVVINEKLMNNHQLELAKQLHKEGHLFYCTC

• Full Name: asparagine-linked glycosylation 13 homolog
• Calculated Molecular Weight: 1137 aa, 126 kDa
• Observed Molecular Weight: 130-135 kDa, 18 kDa
• GenBank Accession Number: BC005336
• Gene Symbol: ALG13
• Gene ID (NCBI): 79868
• RRID: AB_2918198
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NP73
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The ALG13 Polyclonal antibody (Cat# 28738-1-AP) has 3 total citations. These appear in Nature Metabolism, Blood, and Frontiers in Cell and Developmental Biology. The associated research fields include glycosylation and Alzheimer's disease metabolism, acute myeloid leukemia drug resistance and splicing regulation, and enzymatic characterization of the ALG13/14 UDP-N-acetylglucosamine transferase heterodimer.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Nat Metab; Hyperglycosylation is a metabolic driver of Alzheimer's disease.; Authors - Tara R. Hawkinson
human	WB	Blood; Targeting PRMT9 Overcomes Venetoclax Resistance in AML by Modulating Splicing and Inhibiting Translation; Authors - Yang Li
human	WB	Front Cell Dev Biol; An in vitro assay for enzymatic studies on human ALG13/14 heterodimeric UDP-N-acetylglucosamine transferase; Authors - Chun-Di Wang