ALG13 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ALG13 Polyclonal antibody (28738-1-AP)

ALG13 Polyclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 28738-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF-P, ELISA

Synonyms

Asparagine-linked glycosylation 13 homolog, CXorf45, EC:2.4.1.141, GLT28D1, Glycosyltransferase 28 domain-containing protein 1

• 

  WB analysis using 28738-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 28738-1-AP (ALG13 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 28738-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 28738-1-AP (ALG13 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 28738-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 28738-1-AP (ALG13 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse brain using 28738-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using ALG13 antibody (28738-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: Jurkat cells
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28738-1-AP targets ALG13 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30299

  Product name: Recombinant human ALG13 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 45-127 aa of BC005336

  Sequence: TVVPEPFSTESFTLDVYRYKDSLKEDIQKADLVISHAGAGSCLETLEKGKPLVVVINEKLMNNHQLELAKQLHKEGHLFYCTC

• Full Name: asparagine-linked glycosylation 13 homolog
• Calculated Molecular Weight: 1137 aa, 126 kDa
• Observed Molecular Weight: 130-135 kDa, 18 kDa
• GenBank Accession Number: BC005336
• Gene Symbol: ALG13
• Gene ID (NCBI): 79868
• RRID: AB_2918198
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NP73
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Blood; Targeting PRMT9 Overcomes Venetoclax Resistance in AML by Modulating Splicing and Inhibiting Translation; Authors - Yang Li
human	WB	Front Cell Dev Biol; An in vitro assay for enzymatic studies on human ALG13/14 heterodimeric UDP-N-acetylglucosamine transferase; Authors - Chun-Di Wang
mouse	IF	Nat Metab; Hyperglycosylation is a metabolic driver of Alzheimer's disease.; Authors - Tara R. Hawkinson