ALG13 Monoclonal antibody

• 

  WB analysis using 67283-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67283-1-Ig (ALG13 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

ALG13 Monoclonal Antibody for WB, ELISA

Cat No. 67283-1-Ig

Clone No.3B8G3

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, ELISA

Synonyms

3B8G3, Asparagine-linked glycosylation 13 homolog, CXorf45, EC:2.4.1.141, GLT28D1

---

Tested Applications

• Positive WB detected in: MCF-7 cells, HeLa cells, HEK-293 cells, K-562 cells, Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67283-1-Ig targets ALG13 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14955

  Product name: Recombinant human ALG13 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-165 aa of BC005336

  Sequence: MKCVFVTVGTTSFDDLIACVSAPDSLQKIESLGYNRLILQIGRGTVVPEPFSTESFTLDVYRYKDSLKEDIQKADLVISHAGAGSCLETLEKGKPLVVVINEKLMNNHQLELAKQLHKEGHLFYCTCSTLPGLLQSMDLSTLKCYPPGQPEKFSAFLDKVVGLQK

• Full Name: asparagine-linked glycosylation 13 homolog
• Calculated Molecular Weight: 1137 aa, 126 kDa
• Observed Molecular Weight: 130-135 kDa
• GenBank Accession Number: BC005336
• Gene Symbol: ALG13
• Gene ID (NCBI): 79868
• RRID: AB_2882550
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9NP73
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.