ALG2 Polyclonal antibody, PBS Only

• 

  WB analysis using 15092-1-AP (same clone as 15092-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15092-1-AP (ALG2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15092-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 15092-1-AP (same clone as 15092-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 15092-1-AP (ALG2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15092-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 15092-1-AP (same clone as 15092-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 15092-1-AP (ALG2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15092-1-PBS in a different storage buffer formulation.

ALG2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 15092-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

15092-1-PBS targets ALG2 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4833

  Product name: Recombinant human ALG2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 32-323 aa of BC015126

  Sequence: RLARRRKKILFYCHFPDLLLTKRDSFLKRLYRAPIDWIEEYTTGMADCILVNSQFTAAVFKETFKSLSHIDPDVLYPSLNVTSFDSVVPEKLDDLVPKGKKFLLLSINRYERKKNLTLALEALVQLRGRLTSQDWERVHLIVAGGYDERVLENVEHYQELKKMVQQSDLGQYVTFLRSFSDKQKISLLHSCTCVLYTPSNEHFGIVPLEAMYMQCPVIAVNSGGPLESIDHSVTGFLCEPDPVHFSEAIEKFIREPSLKATMGLAGRARVKEKFSPEAFTEQLYRYVTKLLV

• Full Name: asparagine-linked glycosylation 2, alpha-1,3-mannosyltransferase homolog (S. cerevisiae)
• Calculated Molecular Weight: 22 kDa
• Observed Molecular Weight: 47 kDa, 37 kDa
• GenBank Accession Number: BC015126
• Gene Symbol: ALG2
• Gene ID (NCBI): 85365
• RRID: AB_2878108
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H553
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.