ALG3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ALG3 Polyclonal antibody (28084-1-AP)

ALG3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 28084-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF, ELISA

Synonyms

Asparagine-linked glycosylation protein 3 homolog, CDGS4, D16Ertd36e, Dolichyl-phosphate-mannose--glycolipid alpha-mannosyltransferase, Dolichyl-P-Man:Man(5)GlcNAc(2)-PP-dolichyl mannosyltransferase

• 

  WB analysis of HeLa using 28084-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 28084-1-AP (ALG3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse placenta using 28084-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse placenta tissue slide using 28084-1-AP (ALG3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse placenta using 28084-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse placenta tissue slide using 28084-1-AP (ALG3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse small intestine using 28084-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse small intestine tissue slide using 28084-1-AP (ALG3 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 28084-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 28084-1-AP (ALG3 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse kidney using 28084-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 28084-1-AP (ALG3 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 28084-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 28084-1-AP (ALG3 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat liver using 28084-1-AP

  Immunohistochemical analysis of paraffin-embedded rat liver tissue slide using 28084-1-AP (ALG3 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat small intestine using 28084-1-AP

  Immunohistochemical analysis of paraffin-embedded rat small intestine tissue slide using 28084-1-AP (ALG3 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ALG3 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, MCF-7 cells, human placenta tissue, mouse liver tissue
• Positive IHC detected in: mouse placenta tissue, rat small intestine tissue, rat liver tissue, mouse liver tissue, human stomach cancer tissue, mouse small intestine tissue, mouse kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28084-1-AP targets ALG3 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26382

  Product name: Recombinant human ALG3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-199 aa of BC002839

  Sequence: MAAGLRKRGRSGSAAQAEGLCKQWLQRAWQERRLLLREPRYTLLVAACLCLAEVGITFWVIHRVAYTEIDWKAYMAEVEGVINGTYDYTQLQGDTGPLVYPAGFVYIFMGLYYATSRGTDIRMAQNIFAVLYLATLLLVFLIYHQTCKVPPFVFFFMCCASYRVHSIFVLRLFNDPVAMVLLFLSINLLLAQRWGWGCC

• Full Name: asparagine-linked glycosylation 3, alpha-1,3- mannosyltransferase homolog (S. cerevisiae)
• Calculated Molecular Weight: 438 aa, 50 kDa
• Observed Molecular Weight: 50-60 kDa
• GenBank Accession Number: BC002839
• Gene Symbol: ALG3
• Gene ID (NCBI): 10195
• RRID: AB_3669644
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92685
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Alpha-1,3-mannosyltransferase (ALG3) encodes an endoplasmic reticulum-localized ALG3 family member that participates in N-glycan synthesis. ALG3 contributes to high mannose-type N-glycans in several cancers, and mannose-type N-glycan upregulation has been shown to be related to cancer progression. ALG3 is overexpressed in oral squamous cell carcinoma(PMID: 33084111), non-small cell lung cancer(PMID: 31899049), and breast cancer(PMID: 33931075) and hepatocellular carcinoma(PMID: 35782861).

Publications

What published studies show

The ALG3 Polyclonal antibody (Cat# 28084-1-AP) has 2 total citations. These appear in Computational Biology and Medicine (IF 7.7) and Cell Stress and Chaperones (IF 4.1). The research fields span pan-cancer multi-omics analysis involving CD8+ T cell infiltration and chemokine-mediated 5-fluorouracil sensitivity, as well as α-1,3-mannosyltransferase inhibition in head and neck squamous cell carcinoma related to cetuximab response and endoplasmic reticulum stress. Cited applications include WB, IF, and IHC in human samples.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IF	Comput Biol Med; Deep pan-cancer analysis and multi-omics evidence reveal that ALG3 inhibits CD8+ T cell infiltration by suppressing chemokine secretion and is associated with 5-fluorouracil sensitivity; Authors - Zhixuan Wu
human	IHC	Cell Stress Chaperones; Inhibition of α-1,3-mannosyltransferase sensitizes head and neck squamous cell carcinomas to cetuximab via endoplasmic reticulum stress.; Authors - Yu Hao