ALKBH1 Polyclonal antibody

• 

  IHC staining of human pancreas using 13234-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas tissue slide using 13234-1-AP (ALKBH1 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human pancreas using 13234-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas tissue slide using 13234-1-AP (ALKBH1 Antibody) at dilution of 1:50 (under 40x lens).

ALKBH1 Polyclonal Antibody for ELISA

Cat No. 13234-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Synonyms

ABH, ABH1, alkB, ALKBH, ALKBH1, DNA lyase ABH1, hABH

---

Product Information

13234-1-AP targets ALKBH1 in ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4027

  Product name: Recombinant human ALKBH1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 41-389 aa of BC025787

  Sequence: EGVIDFSAAHAARGKGPGAQKVIKSQLNVSSVSEQNAYRAGLQPVSKWQAYGLKGYPGFIFIPNPFLPGYQWHWVKQCLKLYSQKPNVCNLDKHMSKEETQDLWEQSKEFLRYKEATKRRPRSLLEKLRWVTVGYHYNWDSKKYSADHYTPFPSDLGFLSEQVAAACGFEDFRAEAGILNYYRLDSTLGIHVDRSELDHSKPLLSFSFGQSAIFLLGGLQRDEAPTAMFMHSGDIMIMSGFSRLLNHAVPRVLPNPEGEGLPHCLEAPLPAVLPRDSMVEPCSMEDWQVCASYLKTARVNMTVRQVLATDQNFPLEPIEDEKRDISTEGFCHLDDQNSEVKRARINPHS

• Full Name: alkB, alkylation repair homolog 1 (E. coli)
• Calculated Molecular Weight: 389 aa, 44 kDa
• Observed Molecular Weight: 34 kDa
• GenBank Accession Number: BC025787
• Gene Symbol: ALKBH1
• Gene ID (NCBI): 8846
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13686
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.