ALOX15 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ALOX15 Polyclonal antibody (13286-1-AP)

• 

  WB analysis using 13286-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13286-1-AP (ALOX15 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

ALOX15 Polyclonal Antibody for WB, ELISA

Cat No. 13286-1-AP

Publications(6)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

15LOX, 15 LOX2, 15 LOX 1, 15 LOX, 12-LOX

---

Tested Applications

• Positive WB detected in: mouse colon tissue, rat colon tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 6 publications below
• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

13286-1-AP targets ALOX15 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4040

  Product name: Recombinant human ALOX15 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-353 aa of BC029032

  Sequence: MGLYRIRVSTGASLYAGSNNQVQLWLVGQHGEAALGKRLWPARGKETELKVEVPEYLGPLLFVKLRKRHLLKDDAWFCNWISVQGPGAGDEVRFPCYRWVEGNGVLSLPEGTGRTVGEDPQGLFQKHREEELEERRKLYRWGNWKDGLILNMAGAKLYDLPVDERFLEDKRVDFEVSLAKGLADLAIKDSLNVLTCWKDLDDFNRIFWCGQSKLAERVRDSWKEDALFGYQFLNGANPVVLRRSAHLPARLVFPPGMEELQAQLEKELEGGTLFEADFSLLDGIKANVILCSQQHLAAPLVMLKLQPDGKLLPMVIQLQLPRTGSPPPPLFLPTDPPMAWLLAKCWVRSSDFQ

• Full Name: arachidonate 15-lipoxygenase
• Calculated Molecular Weight: 662 aa, 75 kDa
• Observed Molecular Weight: 70-75 kDa
• GenBank Accession Number: BC029032
• Gene Symbol: ALOX15
• Gene ID (NCBI): 246
• RRID: AB_3669158
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P16050
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB	Curr Res Food Sci; Monitoring early micro-oxidation under refrigeration: iron and oxidative markers predict quality loss in grass carp.; Authors - Xin Xiong
mouse	WB	Pharmaceuticals (Basel); Xiebai San Alleviates Allergic Pulmonary Inflammation by Modulating Arachidonic Acid Metabolism.; Authors - Xingnan Yue
	WB	Chem Biol Interact; Formoterol, a clinically approved drug, inhibits ferroptosis by suppressing lipid peroxidation and attenuates APAP-induced acute liver injury; Authors - Lin-Song Teng
rat	WB,IHC,IF	Free Radic Biol Med; Therapeutic potential of magnesium diboride nanosheets in PAH-associated right heart failure: Integrated multi-omics analysis reveals ferroptosis suppression via LC3/ATG5/NCOA4/FTH1 pathway.; Authors - Qiuhong Jiao
mouse	WB	Phytomedicine; Sanhua essential oil exerts antidepressant effects in breast cancer-related depression by modulating metabolic pathways.; Authors - Xiaofei Li
human	WB	J Agric Food Chem; Combined Toxicity Assessment of Deoxynivalenol and Pb2+ on HK-2 Cells Involved in Excessive ROS-Induced Ferroptosis; Authors - Zuoyin Zhu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Nazek (Verified Customer) (08-07-2025)

tooooo many non-specific bands seen in the western blot

• Applications: Western Blot
• Primary Antibody Dilution: 1:500
• Cell Tissue Type: neuroblastoma protein lysates

ALOX15 Antibody Western Blot validation (1:500 dilution) in neuroblastoma protein lysates (Cat no:13286-1-AP)