ALOX5AP Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ALOX5AP Polyclonal antibody, PBS Only (12864-1-PBS)

• 

  WB analysis using 12864-1-AP (same clone as 12864-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12864-1-AP (ALOX5AP antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12864-1-PBS in a different storage buffer formulation.

ALOX5AP Polyclonal Antibody for WB, Indirect ELISA

Cat No. 12864-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

MK-886-binding protein, MK 886 binding protein, FLAP, Arachidonate 5-lipoxygenase-activating protein, AL5AP

---

Product Information

12864-1-PBS targets ALOX5AP in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3144

  Product name: Recombinant human ALOX5AP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-161 aa of BC018538

  Sequence: MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP

• Full Name: arachidonate 5-lipoxygenase-activating protein
• Calculated Molecular Weight: 18 kDa
• Observed Molecular Weight: 15-17 kDa
• GenBank Accession Number: BC018538
• Gene Symbol: ALOX5AP
• Gene ID (NCBI): 241
• RRID: AB_3669149
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P20292
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.