ALR Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84972-4-RR (same clone as 84972-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84972-4-RR (GFER antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84972-4-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 84972-4-RR (same clone as 84972-4-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 84972-4-RR (ALR antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84972-4-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 84972-4-RR (same clone as 84972-4-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 84972-4-RR (ALR antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84972-4-PBS in a different storage buffer formulation.

• 

  FC experiment of HepG2 using 84972-4-RR (same clone as 84972-4-PBS)

  1x10^6 HepG2 cells were intracellularly stained with 0.25 ug ALR Recombinant antibody (84972-4-RR, Clone:242557G3) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C). This data was developed using the same antibody clone with 84972-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84972-4-RR

  Biolayer interferometry (BLl) kinetic assays of 84972-4-RR against Human ALR were performed. The affinity constant is 0.23 nM.

ALR Uni-rAb^® Recombinant Antibody for WB, IHC, FC (Intra), Indirect ELISA

Cat No. 84972-4-PBS

Clone No.242557G3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, FC (Intra), Indirect ELISA

Synonyms

GFER, 242557G3, EC:1.8.3.2, ERV1, FAD-linked sulfhydryl oxidase ALR

---

Product Information

84972-4-PBS targets ALR in WB, IHC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1840

  Product name: Recombinant human GFER protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-125 aa of BC028348

  Sequence: MRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD

• Full Name: growth factor, augmenter of liver regeneration
• Calculated Molecular Weight: 15 kDa, 23 kDa
• Observed Molecular Weight: 23-25 kDa
• GenBank Accession Number: BC028348
• Gene Symbol: GFER
• Gene ID (NCBI): 2671
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P55789
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GFER (FAD-linked sulfhydryl oxidase) is also named as ALR, HERV1, HPO. It plays an important role in the disulfide relay system (DRS) in human mitochondria. The GFER gene codes for 2 distinct isoforms that are probably synthesized from the same mRNA with the use of different initiation codons. The long isoform (205 amino acids, 23/21 kD) is located mainly in the mitochondrial intermembrane space and exists under nonreducing and nondenaturing conditions as a homodimer and a heterodimer. The shorter isoform (125 amino acids, 15 kD), which lacks 80 amino acids at its N terminus compared to the longer isoform, is present predominantly in the nucleus (PMID: 19409522, 24880092, 21152698).