AMAC1L2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• AMAC1L2 Polyclonal antibody, PBS Only (30979-1-PBS)

• 

  WB analysis using 30979-1-AP (same clone as 30979-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30979-1-AP (AMAC1L2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30979-1-PBS in a different storage buffer formulation.

AMAC1L2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 30979-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Protein AMAC1L2, AMAC

---

Product Information

30979-1-PBS targets AMAC1L2 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34353

  Product name: Recombinant human AMAC1L2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-36 aa of BC131696

  Sequence: MAGSHPYFNLPDSTHPSPPSAPPSLRWHQRCQPSGA

• Full Name: acyl-malonyl condensing enzyme 1-like 2
• Calculated Molecular Weight: 388 aa, 35 kDa
• Observed Molecular Weight: 34 kDa
• GenBank Accession Number: BC131696
• Gene Symbol: AMAC1L2
• Gene ID (NCBI): 83650
• RRID: AB_3669803
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q96KT7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

AMAC1L2, also known as SLC35G5, belongs to the transporter protein family 35 member G5. This protein has an N-terminal α-helix, a central β-side and a C-terminal structural domain at the cell membrane. The role of SLC35G5 in the tumor microenvironment as a drug target and also as a biomarker for diagnosis and treatment monitoring.