Product Information
30979-1-PBS targets AMAC1L2 in WB, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag34353 Product name: Recombinant human AMAC1L2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-36 aa of BC131696 Sequence: MAGSHPYFNLPDSTHPSPPSAPPSLRWHQRCQPSGA Predict reactive species |
| Full Name | acyl-malonyl condensing enzyme 1-like 2 |
| Calculated Molecular Weight | 388 aa, 35 kDa |
| Observed Molecular Weight | 34 kDa |
| GenBank Accession Number | BC131696 |
| Gene Symbol | AMAC1L2 |
| Gene ID (NCBI) | 83650 |
| RRID | AB_3669803 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q96KT7 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
AMAC1L2, also known as SLC35G5, belongs to the transporter protein family 35 member G5. This protein has an N-terminal α-helix, a central β-side and a C-terminal structural domain at the cell membrane. The role of SLC35G5 in the tumor microenvironment as a drug target and also as a biomarker for diagnosis and treatment monitoring.

